Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Translation initiation factor eIF-2B subunit delta

Gene

Eif2b4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Initiation factor

Keywords - Biological processi

Protein biosynthesis

Enzyme and pathway databases

ReactomeiR-MMU-72731. Recycling of eIF2:GDP.

Names & Taxonomyi

Protein namesi
Recommended name:
Translation initiation factor eIF-2B subunit delta
Alternative name(s):
eIF-2B GDP-GTP exchange factor subunit delta
Gene namesi
Name:Eif2b4
Synonyms:Eif2b, Eif2bd, Jgr1a
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:95300. Eif2b4.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00001560682 – 524Translation initiation factor eIF-2B subunit deltaAdd BLAST523

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1
Modified residuei12PhosphoserineBy similarity1
Modified residuei86PhosphothreonineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ61749.
PaxDbiQ61749.
PRIDEiQ61749.

PTM databases

iPTMnetiQ61749.
PhosphoSitePlusiQ61749.

Expressioni

Gene expression databases

BgeeiENSMUSG00000029145.
ExpressionAtlasiQ61749. baseline and differential.
GenevisibleiQ61749. MM.

Interactioni

Subunit structurei

Complex of five different subunits; alpha, beta, gamma, delta and epsilon.

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000110250.

Structurei

3D structure databases

ProteinModelPortaliQ61749.
SMRiQ61749.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1467. Eukaryota.
COG1184. LUCA.
GeneTreeiENSGT00550000075009.
HOGENOMiHOG000176924.
HOVERGENiHBG051459.
InParanoidiQ61749.
KOiK03680.
OrthoDBiEOG091G09DP.
TreeFamiTF101508.

Family and domain databases

InterProiIPR000649. IF-2B-related.
[Graphical view]
PfamiPF01008. IF-2B. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q61749-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAVAVAVRE ESRSEMKTEL SPRPGAAGRE LTQEEKLQLR KEKKQQKKKR
60 70 80 90 100
KEEKGADQEI GSAVSAAQRQ DPIRELPGPG SQLGGTAGEK LPAGRSKAEL
110 120 130 140 150
RAERRAKQEA ERALKQARKG EQGGVPPQAC PSTAGETTSG VKRVPEHTPA
160 170 180 190 200
DDPTLLRRLL RKPDRQQVPT RKDYGSKVSL FSHLPQYSRQ SSLTQYMSIP
210 220 230 240 250
SSVIHPAMVR LGLQYSQGLI SGSNARCIAL LHALQQVIQD YTTPPSEELS
260 270 280 290 300
RDLVNKLKPY ISFLTQCRPM SASMCNAIKF LTKEVTGMSS SKREEEAKSE
310 320 330 340 350
LREALDRYVQ EKIVLAAQAI SRFASTKISD GDVILVYGCS SLVSRILQEA
360 370 380 390 400
RVEGRRFRVV VVDSRPRLEG RHMLHSLVRA GVPTSYLLIP AASYVLPEVS
410 420 430 440 450
KVLLGAHALL ANGSVMSRVG TAQLALVARA HNVPVLVCCE TYKFCERVQT
460 470 480 490 500
DAFVSNELDD PDDLQCKRGD QVALANWQSH PSLRLLNLVY DVTPPELVDL
510 520
VITELGMIPC SSVPVVLRVK SSDQ
Length:524
Mass (Da):57,624
Last modified:July 27, 2011 - v2
Checksum:i86CDB70C63285A02
GO
Isoform 2 (identifier: Q61749-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MAAVAVAVRE → MPTQQPAAPTSLPKSSRSLSGSLCALFSDA

Show »
Length:544
Mass (Da):59,657
Checksum:iD46CB29EB50B6C42
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti302R → K in AAA68046 (PubMed:7982969).Curated1
Sequence conflicti302R → K in AAA68047 (PubMed:7982969).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0014341 – 10MAAVAVAVRE → MPTQQPAAPTSLPKSSRSLS GSLCALFSDA in isoform 2. 1 Publication10

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M98036 mRNA. Translation: AAA68047.1.
M98035 mRNA. Translation: AAA68046.1.
AK158282 mRNA. Translation: BAE34444.1.
CH466524 Genomic DNA. Translation: EDL37345.1.
BC021884 mRNA. Translation: AAH21884.1.
CCDSiCCDS19176.1. [Q61749-1]
CCDS51457.1. [Q61749-2]
PIRiA55146.
RefSeqiNP_001120827.1. NM_001127355.1. [Q61749-2]
NP_001120828.1. NM_001127356.1. [Q61749-2]
NP_034252.2. NM_010122.2. [Q61749-1]
UniGeneiMm.29394.

Genome annotation databases

EnsembliENSMUST00000077693; ENSMUSP00000076875; ENSMUSG00000029145. [Q61749-1]
ENSMUST00000114603; ENSMUSP00000110250; ENSMUSG00000029145. [Q61749-2]
ENSMUST00000166769; ENSMUSP00000130880; ENSMUSG00000029145. [Q61749-2]
GeneIDi13667.
KEGGimmu:13667.
UCSCiuc008wxk.2. mouse. [Q61749-2]
uc008wxl.2. mouse. [Q61749-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M98036 mRNA. Translation: AAA68047.1.
M98035 mRNA. Translation: AAA68046.1.
AK158282 mRNA. Translation: BAE34444.1.
CH466524 Genomic DNA. Translation: EDL37345.1.
BC021884 mRNA. Translation: AAH21884.1.
CCDSiCCDS19176.1. [Q61749-1]
CCDS51457.1. [Q61749-2]
PIRiA55146.
RefSeqiNP_001120827.1. NM_001127355.1. [Q61749-2]
NP_001120828.1. NM_001127356.1. [Q61749-2]
NP_034252.2. NM_010122.2. [Q61749-1]
UniGeneiMm.29394.

3D structure databases

ProteinModelPortaliQ61749.
SMRiQ61749.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000110250.

PTM databases

iPTMnetiQ61749.
PhosphoSitePlusiQ61749.

Proteomic databases

EPDiQ61749.
PaxDbiQ61749.
PRIDEiQ61749.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000077693; ENSMUSP00000076875; ENSMUSG00000029145. [Q61749-1]
ENSMUST00000114603; ENSMUSP00000110250; ENSMUSG00000029145. [Q61749-2]
ENSMUST00000166769; ENSMUSP00000130880; ENSMUSG00000029145. [Q61749-2]
GeneIDi13667.
KEGGimmu:13667.
UCSCiuc008wxk.2. mouse. [Q61749-2]
uc008wxl.2. mouse. [Q61749-1]

Organism-specific databases

CTDi8890.
MGIiMGI:95300. Eif2b4.

Phylogenomic databases

eggNOGiKOG1467. Eukaryota.
COG1184. LUCA.
GeneTreeiENSGT00550000075009.
HOGENOMiHOG000176924.
HOVERGENiHBG051459.
InParanoidiQ61749.
KOiK03680.
OrthoDBiEOG091G09DP.
TreeFamiTF101508.

Enzyme and pathway databases

ReactomeiR-MMU-72731. Recycling of eIF2:GDP.

Miscellaneous databases

ChiTaRSiEif2b4. mouse.
PROiQ61749.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000029145.
ExpressionAtlasiQ61749. baseline and differential.
GenevisibleiQ61749. MM.

Family and domain databases

InterProiIPR000649. IF-2B-related.
[Graphical view]
PfamiPF01008. IF-2B. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiEI2BD_MOUSE
AccessioniPrimary (citable) accession number: Q61749
Secondary accession number(s): Q3TYW7, Q61748, Q8VC35
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: July 27, 2011
Last modified: November 2, 2016
This is version 120 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.