Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q61749 (EI2BD_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 96. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Translation initiation factor eIF-2B subunit delta
Alternative name(s):
eIF-2B GDP-GTP exchange factor subunit delta
Gene names
Name:Eif2b4
Synonyms:Eif2b, Eif2bd, Jgr1a
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length524 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.

Subunit structure

Complex of five different subunits; alpha, beta, gamma, delta and epsilon.

Sequence similarities

Belongs to the eIF-2B alpha/beta/delta subunits family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q61749-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q61749-2)

The sequence of this isoform differs from the canonical sequence as follows:
     2-10: AAVAVAVRE → MPTQQPAAPTSLPKSSRSLSGSLCALFSDA

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed By similarity
Chain2 – 524523Translation initiation factor eIF-2B subunit delta
PRO_0000156068

Amino acid modifications

Modified residue21N-acetylalanine By similarity
Modified residue861Phosphothreonine By similarity

Natural variations

Alternative sequence2 – 109AAVAVAVRE → MPTQQPAAPTSLPKSSRSLS GSLCALFSDA in isoform 2.
VSP_001434

Experimental info

Sequence conflict3021R → K in AAA68046. Ref.1
Sequence conflict3021R → K in AAA68047. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 27, 2011. Version 2.
Checksum: 86CDB70C63285A02

FASTA52457,624
        10         20         30         40         50         60 
MAAVAVAVRE ESRSEMKTEL SPRPGAAGRE LTQEEKLQLR KEKKQQKKKR KEEKGADQEI 

        70         80         90        100        110        120 
GSAVSAAQRQ DPIRELPGPG SQLGGTAGEK LPAGRSKAEL RAERRAKQEA ERALKQARKG 

       130        140        150        160        170        180 
EQGGVPPQAC PSTAGETTSG VKRVPEHTPA DDPTLLRRLL RKPDRQQVPT RKDYGSKVSL 

       190        200        210        220        230        240 
FSHLPQYSRQ SSLTQYMSIP SSVIHPAMVR LGLQYSQGLI SGSNARCIAL LHALQQVIQD 

       250        260        270        280        290        300 
YTTPPSEELS RDLVNKLKPY ISFLTQCRPM SASMCNAIKF LTKEVTGMSS SKREEEAKSE 

       310        320        330        340        350        360 
LREALDRYVQ EKIVLAAQAI SRFASTKISD GDVILVYGCS SLVSRILQEA RVEGRRFRVV 

       370        380        390        400        410        420 
VVDSRPRLEG RHMLHSLVRA GVPTSYLLIP AASYVLPEVS KVLLGAHALL ANGSVMSRVG 

       430        440        450        460        470        480 
TAQLALVARA HNVPVLVCCE TYKFCERVQT DAFVSNELDD PDDLQCKRGD QVALANWQSH 

       490        500        510        520 
PSLRLLNLVY DVTPPELVDL VITELGMIPC SSVPVVLRVK SSDQ 

« Hide

Isoform 2 [UniParc].

Checksum: C5E177EC6EFB6C42
Show »

FASTA54559,789

References

« Hide 'large scale' references
[1]"The delta-subunit of murine guanine nucleotide exchange factor eIF-2B. Characterization of cDNAs predicts isoforms differing at the amino-terminal end."
Henderson R.A., Krissansen G.W., Yong R.Y., Leung E., Watson J.D., Dholakia J.N.
J. Biol. Chem. 269:30517-30523(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
Strain: CBA/J.
Tissue: Spleen.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
Strain: C57BL/6J.
Tissue: Inner ear.
[3]Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Salivary gland.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
M98036 mRNA. Translation: AAA68047.1.
M98035 mRNA. Translation: AAA68046.1.
AK158282 mRNA. Translation: BAE34444.1.
CH466524 Genomic DNA. Translation: EDL37345.1.
BC021884 mRNA. Translation: AAH21884.1.
PIRA55146.
RefSeqNP_001120827.1. NM_001127355.1.
NP_001120828.1. NM_001127356.1.
NP_034252.2. NM_010122.2.
UniGeneMm.29394.

3D structure databases

ProteinModelPortalQ61749.
SMRQ61749. Positions 207-522.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ61749.

Proteomic databases

PaxDbQ61749.
PRIDEQ61749.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000077693; ENSMUSP00000076875; ENSMUSG00000029145. [Q61749-1]
ENSMUST00000114603; ENSMUSP00000110250; ENSMUSG00000029145. [Q61749-2]
ENSMUST00000166769; ENSMUSP00000130880; ENSMUSG00000029145. [Q61749-2]
GeneID13667.
KEGGmmu:13667.
UCSCuc008wxk.2. mouse. [Q61749-2]
uc008wxl.2. mouse. [Q61749-1]

Organism-specific databases

CTD8890.
MGIMGI:95300. Eif2b4.

Phylogenomic databases

eggNOGCOG1184.
GeneTreeENSGT00550000075009.
HOGENOMHOG000176924.
HOVERGENHBG051459.
KOK03680.
TreeFamTF101508.

Gene expression databases

ArrayExpressQ61749.
BgeeQ61749.
GenevestigatorQ61749.

Family and domain databases

InterProIPR000649. IF-2B-related.
[Graphical view]
PfamPF01008. IF-2B. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSEIF2B4. mouse.
NextBio284424.
PROQ61749.
SOURCESearch...

Entry information

Entry nameEI2BD_MOUSE
AccessionPrimary (citable) accession number: Q61749
Secondary accession number(s): Q3TYW7, Q61748, Q8VC35
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: July 27, 2011
Last modified: March 19, 2014
This is version 96 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot