SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q61749

- EI2BD_MOUSE

UniProt

Q61749 - EI2BD_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Translation initiation factor eIF-2B subunit delta

Gene
Eif2b4, Eif2b, Eif2bd, Jgr1a
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.

GO - Molecular functioni

  1. guanyl-nucleotide exchange factor activity Source: RefGenome
  2. translation initiation factor activity Source: UniProtKB-KW

GO - Biological processi

  1. cellular response to stimulus Source: UniProtKB
  2. myelination Source: UniProtKB
  3. negative regulation of translational initiation Source: RefGenome
  4. oligodendrocyte development Source: UniProtKB
  5. ovarian follicle development Source: UniProtKB
  6. regulation of GTPase activity Source: GOC
  7. regulation of translational initiation Source: RefGenome
  8. translational initiation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Initiation factor

Keywords - Biological processi

Protein biosynthesis

Names & Taxonomyi

Protein namesi
Recommended name:
Translation initiation factor eIF-2B subunit delta
Alternative name(s):
eIF-2B GDP-GTP exchange factor subunit delta
Gene namesi
Name:Eif2b4
Synonyms:Eif2b, Eif2bd, Jgr1a
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 5

Organism-specific databases

MGIiMGI:95300. Eif2b4.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. eukaryotic translation initiation factor 2B complex Source: UniProtKB
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed By similarity
Chaini2 – 524523Translation initiation factor eIF-2B subunit deltaPRO_0000156068Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine By similarity
Modified residuei86 – 861Phosphothreonine By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ61749.
PaxDbiQ61749.
PRIDEiQ61749.

PTM databases

PhosphoSiteiQ61749.

Expressioni

Gene expression databases

ArrayExpressiQ61749.
BgeeiQ61749.
GenevestigatoriQ61749.

Interactioni

Subunit structurei

Complex of five different subunits; alpha, beta, gamma, delta and epsilon.

Structurei

3D structure databases

ProteinModelPortaliQ61749.
SMRiQ61749. Positions 220-518.

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG1184.
GeneTreeiENSGT00550000075009.
HOGENOMiHOG000176924.
HOVERGENiHBG051459.
KOiK03680.
TreeFamiTF101508.

Family and domain databases

InterProiIPR000649. IF-2B-related.
[Graphical view]
PfamiPF01008. IF-2B. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q61749-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAAVAVAVRE ESRSEMKTEL SPRPGAAGRE LTQEEKLQLR KEKKQQKKKR    50
KEEKGADQEI GSAVSAAQRQ DPIRELPGPG SQLGGTAGEK LPAGRSKAEL 100
RAERRAKQEA ERALKQARKG EQGGVPPQAC PSTAGETTSG VKRVPEHTPA 150
DDPTLLRRLL RKPDRQQVPT RKDYGSKVSL FSHLPQYSRQ SSLTQYMSIP 200
SSVIHPAMVR LGLQYSQGLI SGSNARCIAL LHALQQVIQD YTTPPSEELS 250
RDLVNKLKPY ISFLTQCRPM SASMCNAIKF LTKEVTGMSS SKREEEAKSE 300
LREALDRYVQ EKIVLAAQAI SRFASTKISD GDVILVYGCS SLVSRILQEA 350
RVEGRRFRVV VVDSRPRLEG RHMLHSLVRA GVPTSYLLIP AASYVLPEVS 400
KVLLGAHALL ANGSVMSRVG TAQLALVARA HNVPVLVCCE TYKFCERVQT 450
DAFVSNELDD PDDLQCKRGD QVALANWQSH PSLRLLNLVY DVTPPELVDL 500
VITELGMIPC SSVPVVLRVK SSDQ 524
Length:524
Mass (Da):57,624
Last modified:July 27, 2011 - v2
Checksum:i86CDB70C63285A02
GO
Isoform 2 (identifier: Q61749-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-10: AAVAVAVRE → MPTQQPAAPTSLPKSSRSLSGSLCALFSDA

Show »
Length:545
Mass (Da):59,789
Checksum:iC5E177EC6EFB6C42
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei2 – 109AAVAVAVRE → MPTQQPAAPTSLPKSSRSLS GSLCALFSDA in isoform 2. VSP_001434

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti302 – 3021R → K in AAA68046. 1 Publication
Sequence conflicti302 – 3021R → K in AAA68047. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M98036 mRNA. Translation: AAA68047.1.
M98035 mRNA. Translation: AAA68046.1.
AK158282 mRNA. Translation: BAE34444.1.
CH466524 Genomic DNA. Translation: EDL37345.1.
BC021884 mRNA. Translation: AAH21884.1.
CCDSiCCDS19176.1. [Q61749-1]
PIRiA55146.
RefSeqiNP_001120827.1. NM_001127355.1.
NP_001120828.1. NM_001127356.1.
NP_034252.2. NM_010122.2. [Q61749-1]
UniGeneiMm.29394.

Genome annotation databases

EnsembliENSMUST00000077693; ENSMUSP00000076875; ENSMUSG00000029145. [Q61749-1]
GeneIDi13667.
KEGGimmu:13667.
UCSCiuc008wxk.2. mouse. [Q61749-2]
uc008wxl.2. mouse. [Q61749-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M98036 mRNA. Translation: AAA68047.1 .
M98035 mRNA. Translation: AAA68046.1 .
AK158282 mRNA. Translation: BAE34444.1 .
CH466524 Genomic DNA. Translation: EDL37345.1 .
BC021884 mRNA. Translation: AAH21884.1 .
CCDSi CCDS19176.1. [Q61749-1 ]
PIRi A55146.
RefSeqi NP_001120827.1. NM_001127355.1.
NP_001120828.1. NM_001127356.1.
NP_034252.2. NM_010122.2. [Q61749-1 ]
UniGenei Mm.29394.

3D structure databases

ProteinModelPortali Q61749.
SMRi Q61749. Positions 220-518.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q61749.

Proteomic databases

MaxQBi Q61749.
PaxDbi Q61749.
PRIDEi Q61749.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000077693 ; ENSMUSP00000076875 ; ENSMUSG00000029145 . [Q61749-1 ]
GeneIDi 13667.
KEGGi mmu:13667.
UCSCi uc008wxk.2. mouse. [Q61749-2 ]
uc008wxl.2. mouse. [Q61749-1 ]

Organism-specific databases

CTDi 8890.
MGIi MGI:95300. Eif2b4.

Phylogenomic databases

eggNOGi COG1184.
GeneTreei ENSGT00550000075009.
HOGENOMi HOG000176924.
HOVERGENi HBG051459.
KOi K03680.
TreeFami TF101508.

Miscellaneous databases

ChiTaRSi EIF2B4. mouse.
NextBioi 284424.
PROi Q61749.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q61749.
Bgeei Q61749.
Genevestigatori Q61749.

Family and domain databases

InterProi IPR000649. IF-2B-related.
[Graphical view ]
Pfami PF01008. IF-2B. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The delta-subunit of murine guanine nucleotide exchange factor eIF-2B. Characterization of cDNAs predicts isoforms differing at the amino-terminal end."
    Henderson R.A., Krissansen G.W., Yong R.Y., Leung E., Watson J.D., Dholakia J.N.
    J. Biol. Chem. 269:30517-30523(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Strain: CBA/J.
    Tissue: Spleen.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Strain: C57BL/6J.
    Tissue: Inner ear.
  3. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Salivary gland.

Entry informationi

Entry nameiEI2BD_MOUSE
AccessioniPrimary (citable) accession number: Q61749
Secondary accession number(s): Q3TYW7, Q61748, Q8VC35
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: July 27, 2011
Last modified: September 3, 2014
This is version 101 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi