Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinectin

Gene

Ktn1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor for kinesin thus involved in kinesin-driven vesicle motility. Accumulates in integrin-based adhesion complexes (IAC) upon integrin aggregation by fibronectin (By similarity).By similarity

GO - Molecular functioni

  • kinesin binding Source: MGI

GO - Biological processi

  • microtubule-based movement Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Kinectin
Gene namesi
Name:Ktn1Imported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:109153. Ktn1.

Subcellular locationi

  • Endoplasmic reticulum membrane 1 Publication; Single-pass type II membrane protein 1 Publication

  • Note: Vesicle membrane protein anchored to the endoplasmic reticulum (By similarity). Some isoforms containing the inserts at residues 1007-1035 and 1154-1177 are detected in neurite processes.By similarity

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 88CytoplasmicSequence analysis
Transmembranei9 – 2921Helical; Signal-anchor for type II membrane proteinSequence analysisAdd
BLAST
Topological domaini30 – 13271298LumenalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 13271327KinectinPRO_0000238620Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi69 – 691N-linked (GlcNAc...)Sequence analysis
Modified residuei75 – 751PhosphoserineBy similarity
Modified residuei77 – 771PhosphoserineBy similarity
Cross-linki312 – 312Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity
Glycosylationi1031 – 10311N-linked (GlcNAc...)Sequence analysis
Modified residuei1060 – 10601PhosphoserineBy similarity
Glycosylationi1066 – 10661N-linked (GlcNAc...)Sequence analysis
Modified residuei1290 – 12901PhosphoserineBy similarity

Keywords - PTMi

Glycoprotein, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ61595.
PaxDbiQ61595.
PeptideAtlasiQ61595.
PRIDEiQ61595.

PTM databases

iPTMnetiQ61595.
PhosphoSiteiQ61595.
SwissPalmiQ61595.

Expressioni

Tissue specificityi

Expressed in all tissues examined including 12-day embryo, adult heart, brain, ovary, kidney, lung, small intestine, spleen, thymus and pancreas.1 Publication

Developmental stagei

Isoform 6, isoform 7 and isoform 8 are detected in embryonic hippocampus but not in later developmental stages. Isoform 14, isoform 15 and isoform 16 are adult-specific.1 Publication

Gene expression databases

CleanExiMM_KTN1.

Interactioni

GO - Molecular functioni

  • kinesin binding Source: MGI

Protein-protein interaction databases

BioGridi201049. 74 interactions.
IntActiQ61595. 4 interactions.
MINTiMINT-4109642.
STRINGi10090.ENSMUSP00000022391.

Structurei

3D structure databases

ProteinModelPortaliQ61595.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili329 – 1327999Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi40 – 219180Lys-richSequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the kinectin family.Sequence analysis

Keywords - Domaini

Coiled coil, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IIAW. Eukaryota.
ENOG410YAE3. LUCA.
HOVERGENiHBG007851.
InParanoidiQ61595.
KOiK17975.
PhylomeDBiQ61595.

Family and domain databases

InterProiIPR024854. Kinectin.
[Graphical view]
PANTHERiPTHR18864. PTHR18864. 1 hit.

Sequences (16)i

Sequence statusi: Complete.

This entry describes 16 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q61595-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MELYESTYFI VLIPSVVITV IFLFFWLFMK ETLYDEVLAK QKREQKLIST
60 70 80 90 100
KTDKKKAEKK KNKKKEIQNG TLRESDSEHV PRDFKLSDAS PAEDEQFVPA
110 120 130 140 150
PLNVAETSSS VRERQKKEKK QKPSLEEQVI KESDASKIPG KKVEPVLVTK
160 170 180 190 200
QPAPPPPLEA AALKKKAGQK KSKNGSEEQD KKVEMLMAPS KEQDVLLSHQ
210 220 230 240 250
DTKQEGGLGK KKGLSKKQKS ENVAVLVDEP LIHATTYMPL DNANSNLMMD
260 270 280 290 300
KREIIDMIKP DHVEGIQKSG TKKLKIETDK ENAEVKFKDF LLSLKTMMFS
310 320 330 340 350
EDEALCVVDL LKEKSGVIKE ALKKSNKGEL SGLLHQLQEK ERLLSAMKED
360 370 380 390 400
AAASKERCKR LTQEMMTEKE RSSVVIARMK DRIGTLEKEH NIFQNKMHAS
410 420 430 440 450
YQETQQMQMK FQQVQEQMEA EIAHLKQENG ILRDAVSNTT NQLESKQSAE
460 470 480 490 500
LNKLRQDCGR LVSELNEKTG KLQQEGVQKK NAEQAATQLK VQLQEAERRW
510 520 530 540 550
EEVQSYIRKR TAEHEAAQQD LQSKFVAKEN EVQSLHSKLT DTLVSKQQLE
560 570 580 590 600
QRLMQLMESE QKRASKEESL QIQVQDILEQ NEALKAQIQQ FHSQIAAQTS
610 620 630 640 650
ASVLAEELHK VIAEKDKQLK QTEDSLANEQ DHLASKEEEL KDVQNMNFLL
660 670 680 690 700
KAEVQKWQAL ANEQAATAHE VEKMQKSIHV KEDEIRLLEE QLQHEVASKM
710 720 730 740 750
EELKILSEQN KALQSEVRKL QTAVSQQPNK DVVEQMEKCI QEKDEKLRTV
760 770 780 790 800
EELLETGLIQ VATREEELSA IRTENSTLTR EVQELKAKQS DQVSFVSLIE
810 820 830 840 850
DLKRVIHEKD GQIKSVEELL EVELLKVANK EKTVQALKQE IEVLKEEIGN
860 870 880 890 900
AQLEKAHQLS VTSQVQELQN LLRGKEEQVN SMKAALEDRD RGLTGRGTCA
910 920 930 940 950
QVCSTPQFEE LESVLKEKDN EIKRIEVKLK DTESDVSKMS ELLKEVQEEN
960 970 980 990 1000
KFLKCQLSHQ KHQQASFPSQ EELQTVISEK EKEITDLCNE LESLKNAVEH
1010 1020 1030 1040 1050
QRKKNNDLRE KNWEAMEALA STEKMLQDRV NKTSKERRQH VEAIELESKD
1060 1070 1080 1090 1100
LLKRLFPTVS VPSNLNYSEW LRGFEKKAKA CVAGTSDAEA VKVLEHRLKE
1110 1120 1130 1140 1150
ASEMHTLLQL ECEKYKSVLA ETEGILQKLQ RSVEQEESKW KIKADESQRM
1160 1170 1180 1190 1200
IKQMQSSFTA SERELERLRQ ENKDMENLRR EREHLEMELE KAEMERSTYV
1210 1220 1230 1240 1250
MEVRELKDLL TELQKKLDDS YSEAVRQNEE LNLLKTQLNE THSKLQNEQT
1260 1270 1280 1290 1300
ERKKVADDLH KAQQSLNSIH SKISLKAAGD TVVIENSDIS PEMESPEKET
1310 1320
MSVSLNQTVT QLQQLLQEVN QQLTKET
Length:1,327
Mass (Da):152,592
Last modified:November 1, 1996 - v1
Checksum:i2B79EB332D2470E5
GO
Isoform 21 Publication (identifier: Q61595-2) [UniParc]FASTAAdd to basket
Also known as: KNT11 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1007-1035: Missing.
     1154-1177: Missing.
     1208-1235: Missing.
     1294-1327: ESPEKETMSVSLNQTVTQLQQLLQEVNQQLTKET → SEVIGKLLVRS

Show »
Length:1,200
Mass (Da):137,685
Checksum:i9F21BBF1A1296AF5
GO
Isoform 31 Publication (identifier: Q61595-3) [UniParc]FASTAAdd to basket
Also known as: KNT21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1007-1035: Missing.
     1154-1177: Missing.
     1294-1327: ESPEKETMSVSLNQTVTQLQQLLQEVNQQLTKET → SEVIGKLLVRS

Show »
Length:1,228
Mass (Da):140,972
Checksum:i09D6C89436C027B2
GO
Isoform 41 Publication (identifier: Q61595-4) [UniParc]FASTAAdd to basket
Also known as: KNT31 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1007-1035: Missing.
     1208-1235: Missing.

Show »
Length:1,247
Mass (Da):143,299
Checksum:i8B3CDEC7CE1E27E4
GO
Isoform 51 Publication (identifier: Q61595-5) [UniParc]FASTAAdd to basket
Also known as: KNT41 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1007-1035: Missing.
     1294-1327: ESPEKETMSVSLNQTVTQLQQLLQEVNQQLTKET → SEVIGKLLVRS

Show »
Length:1,275
Mass (Da):146,485
Checksum:i190364AFD891180D
GO
Isoform 61 Publication (identifier: Q61595-6) [UniParc]FASTAAdd to basket
Also known as: KNT51 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1007-1035: Missing.
     1208-1235: Missing.
     1294-1327: ESPEKETMSVSLNQTVTQLQQLLQEVNQQLTKET → SEVIGKLLVRS

Show »
Length:1,247
Mass (Da):143,197
Checksum:i9123822187489987
GO
Isoform 71 Publication (identifier: Q61595-7) [UniParc]FASTAAdd to basket
Also known as: KNT61 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1154-1177: Missing.

Show »
Length:1,280
Mass (Da):147,080
Checksum:i6D3882EAB538508A
GO
Isoform 81 Publication (identifier: Q61595-8) [UniParc]FASTAAdd to basket
Also known as: KNT71 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1154-1177: Missing.
     1208-1235: Missing.

Show »
Length:1,252
Mass (Da):143,793
Checksum:iD29253A8BA93F690
GO
Isoform 91 Publication (identifier: Q61595-9) [UniParc]FASTAAdd to basket
Also known as: KNT81 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1154-1177: Missing.
     1208-1235: Missing.
     1294-1327: ESPEKETMSVSLNQTVTQLQQLLQEVNQQLTKET → SEVIGKLLVRS

Show »
Length:1,252
Mass (Da):143,691
Checksum:iE22B7B345595C1C4
GO
Isoform 101 Publication (identifier: Q61595-10) [UniParc]FASTAAdd to basket
Also known as: KNT91 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1007-1035: Missing.

Show »
Length:1,275
Mass (Da):146,587
Checksum:i6565B2D957BB93B9
GO
Isoform 111 Publication (identifier: Q61595-11) [UniParc]FASTAAdd to basket
Also known as: KNT101 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.

Show »
Length:1,304
Mass (Da):149,991
Checksum:i74F773294C5BB1B8
GO
Isoform 121 Publication (identifier: Q61595-12) [UniParc]FASTAAdd to basket
Also known as: KNT111 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1007-1035: Missing.
     1154-1177: Missing.
     1208-1235: Missing.

Show »
Length:1,223
Mass (Da):140,388
Checksum:i4C404E9FBE28B2CE
GO
Isoform 131 Publication (identifier: Q61595-13) [UniParc]FASTAAdd to basket
Also known as: KNT121 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1208-1235: Missing.
     1294-1327: ESPEKETMSVSLNQTVTQLQQLLQEVNQQLTKET → SEVIGKLLVRS

Show »
Length:1,253
Mass (Da):144,001
Checksum:i7694ED9B53BE5DBE
GO
Isoform 141 Publication (identifier: Q61595-14) [UniParc]FASTAAdd to basket
Also known as: KNT131 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1154-1177: Missing.
     1208-1235: Missing.
     1294-1327: ESPEKETMSVSLNQTVTQLQQLLQEVNQQLTKET → SEVIGKLLVRS

Show »
Length:1,229
Mass (Da):141,090
Checksum:i08BB311C8EFDC879
GO
Isoform 151 Publication (identifier: Q61595-15) [UniParc]FASTAAdd to basket
Also known as: KNT141 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1154-1177: Missing.
     1208-1235: Missing.

Show »
Length:1,275
Mass (Da):146,394
Checksum:iB886D7F71CE5B5BF
GO
Isoform 161 Publication (identifier: Q61595-16) [UniParc]FASTAAdd to basket
Also known as: KNT151 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1007-1035: Missing.
     1208-1235: Missing.
     1294-1327: ESPEKETMSVSLNQTVTQLQQLLQEVNQQLTKET → SEVIGKLLVRS

Show »
Length:1,224
Mass (Da):140,596
Checksum:i092A3F8664BAE6FA
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti10 – 101I → V in BAC30538 (PubMed:16141072).Curated
Sequence conflicti115 – 1151Q → K in BAC30538 (PubMed:16141072).Curated
Sequence conflicti178 – 1781Missing (PubMed:16141072).Curated
Sequence conflicti238 – 2381M → I (PubMed:16141072).Curated
Sequence conflicti360 – 3601R → Q (PubMed:16141072).Curated
Sequence conflicti1118 – 11181V → VS in CAD56927 (PubMed:15316074).Curated
Sequence conflicti1183 – 11831E → G in CAD56935 (PubMed:15316074).Curated
Sequence conflicti1238 – 12381L → F in CAD56936 (PubMed:15316074).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei836 – 85823Missing in isoform 2, isoform 3, isoform 4, isoform 7, isoform 8, isoform 10, isoform 11, isoform 12, isoform 13, isoform 14 and isoform 16. 1 PublicationVSP_052042Add
BLAST
Alternative sequencei1007 – 103529Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 6, isoform 10, isoform 12 and isoform 16. 1 PublicationVSP_052043Add
BLAST
Alternative sequencei1154 – 117724Missing in isoform 2, isoform 3, isoform 7, isoform 8, isoform 9, isoform 12, isoform 14 and isoform 15. 1 PublicationVSP_052044Add
BLAST
Alternative sequencei1208 – 123528Missing in isoform 2, isoform 4, isoform 6, isoform 8, isoform 9, isoform 12, isoform 13, isoform 14, isoform 15 and isoform 16. 1 PublicationVSP_052045Add
BLAST
Alternative sequencei1294 – 132734ESPEK…LTKET → SEVIGKLLVRS in isoform 2, isoform 3, isoform 5, isoform 6, isoform 9, isoform 13, isoform 14 and isoform 16. 1 PublicationVSP_052046Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L43326 mRNA. Translation: AAB65839.1.
AK040200 mRNA. Translation: BAC30538.1.
AJ517365 mRNA. Translation: CAD56924.1.
AJ517366 mRNA. Translation: CAD56925.1.
AJ517367 mRNA. Translation: CAD56926.1.
AJ517368 mRNA. Translation: CAD56927.1.
AJ517369 mRNA. Translation: CAD56928.1.
AJ517370 mRNA. Translation: CAD56929.1.
AJ517371 mRNA. Translation: CAD56930.1.
AJ517372 mRNA. Translation: CAD56931.1.
AJ517373 mRNA. Translation: CAD56932.1.
AJ517374 mRNA. Translation: CAD56933.1.
AJ517375 mRNA. Translation: CAD56934.1.
AJ517376 mRNA. Translation: CAD56935.1.
AJ517377 mRNA. Translation: CAD56936.1.
AJ517378 mRNA. Translation: CAD56937.1.
AJ517379 mRNA. Translation: CAD56938.1.
AJ517380 mRNA. Translation: CAD56939.1.
AJ517381 mRNA. Translation: CAD56940.1.
AJ517382 mRNA. Translation: CAD56941.1.
AJ517383 mRNA. Translation: CAD56942.1.
AJ517384 mRNA. Translation: CAD56943.1.
CCDSiCCDS36900.1. [Q61595-1]
RefSeqiNP_001280564.1. NM_001293635.1.
NP_001280565.1. NM_001293636.1.
NP_032503.2. NM_008477.2.
UniGeneiMm.3110.

Genome annotation databases

GeneIDi16709.
KEGGimmu:16709.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L43326 mRNA. Translation: AAB65839.1.
AK040200 mRNA. Translation: BAC30538.1.
AJ517365 mRNA. Translation: CAD56924.1.
AJ517366 mRNA. Translation: CAD56925.1.
AJ517367 mRNA. Translation: CAD56926.1.
AJ517368 mRNA. Translation: CAD56927.1.
AJ517369 mRNA. Translation: CAD56928.1.
AJ517370 mRNA. Translation: CAD56929.1.
AJ517371 mRNA. Translation: CAD56930.1.
AJ517372 mRNA. Translation: CAD56931.1.
AJ517373 mRNA. Translation: CAD56932.1.
AJ517374 mRNA. Translation: CAD56933.1.
AJ517375 mRNA. Translation: CAD56934.1.
AJ517376 mRNA. Translation: CAD56935.1.
AJ517377 mRNA. Translation: CAD56936.1.
AJ517378 mRNA. Translation: CAD56937.1.
AJ517379 mRNA. Translation: CAD56938.1.
AJ517380 mRNA. Translation: CAD56939.1.
AJ517381 mRNA. Translation: CAD56940.1.
AJ517382 mRNA. Translation: CAD56941.1.
AJ517383 mRNA. Translation: CAD56942.1.
AJ517384 mRNA. Translation: CAD56943.1.
CCDSiCCDS36900.1. [Q61595-1]
RefSeqiNP_001280564.1. NM_001293635.1.
NP_001280565.1. NM_001293636.1.
NP_032503.2. NM_008477.2.
UniGeneiMm.3110.

3D structure databases

ProteinModelPortaliQ61595.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi201049. 74 interactions.
IntActiQ61595. 4 interactions.
MINTiMINT-4109642.
STRINGi10090.ENSMUSP00000022391.

PTM databases

iPTMnetiQ61595.
PhosphoSiteiQ61595.
SwissPalmiQ61595.

Proteomic databases

MaxQBiQ61595.
PaxDbiQ61595.
PeptideAtlasiQ61595.
PRIDEiQ61595.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi16709.
KEGGimmu:16709.

Organism-specific databases

CTDi3895.
MGIiMGI:109153. Ktn1.

Phylogenomic databases

eggNOGiENOG410IIAW. Eukaryota.
ENOG410YAE3. LUCA.
HOVERGENiHBG007851.
InParanoidiQ61595.
KOiK17975.
PhylomeDBiQ61595.

Miscellaneous databases

PROiQ61595.
SOURCEiSearch...

Gene expression databases

CleanExiMM_KTN1.

Family and domain databases

InterProiIPR024854. Kinectin.
[Graphical view]
PANTHERiPTHR18864. PTHR18864. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiKTN1_MOUSE
AccessioniPrimary (citable) accession number: Q61595
Secondary accession number(s): Q8BG49
, Q8BHF4, Q8BHM8, Q8C9Y5, Q8CG51, Q8CG52, Q8CG53, Q8CG54, Q8CG55, Q8CG56, Q8CG57, Q8CG58, Q8CG59, Q8CG60, Q8CG61, Q8CG62, Q8CG63
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: November 1, 1996
Last modified: September 7, 2016
This is version 103 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.