SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q61481

- PDE1A_MOUSE

UniProt

Q61481 - PDE1A_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A

Gene
Pde1a
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a higher affinity for cGMP than for cAMP By similarity.

Catalytic activityi

Nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate.

Cofactori

Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions By similarity.

Enzyme regulationi

Type I PDE are activated by the binding of calmodulin in the presence of Ca2+.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei239 – 2391Proton donor By similarity
Metal bindingi243 – 2431Divalent metal cation 1 By similarity
Metal bindingi279 – 2791Divalent metal cation 1 By similarity
Metal bindingi280 – 2801Divalent metal cation 1 By similarity
Metal bindingi280 – 2801Divalent metal cation 2 By similarity
Metal bindingi386 – 3861Divalent metal cation 1 By similarity

GO - Molecular functioni

  1. 3',5'-cyclic-AMP phosphodiesterase activity Source: Ensembl
  2. calcium- and calmodulin-regulated 3',5'-cyclic-GMP phosphodiesterase activity Source: MGI
  3. calmodulin-dependent cyclic-nucleotide phosphodiesterase activity Source: MGI
  4. cGMP binding Source: Ensembl
  5. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. cAMP catabolic process Source: Ensembl
  2. cGMP catabolic process Source: Ensembl
  3. regulation of smooth muscle cell apoptotic process Source: Ensembl
  4. regulation of smooth muscle cell proliferation Source: Ensembl
  5. signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

Calmodulin-binding, cAMP, cGMP, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_227001. Cam-PDE 1 activation.

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A (EC:3.1.4.17)
Short name:
Cam-PDE 1A
Alternative name(s):
61 kDa Cam-PDE
Gene namesi
Name:Pde1a
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Unplaced

Organism-specific databases

MGIiMGI:1201792. Pde1a.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: Ensembl
  2. neuronal cell body Source: Ensembl
  3. nucleus Source: Ensembl
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 565565Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1APRO_0000198786Add
BLAST

Proteomic databases

MaxQBiQ61481.
PaxDbiQ61481.
PRIDEiQ61481.

PTM databases

PhosphoSiteiQ61481.

Expressioni

Gene expression databases

ArrayExpressiQ61481.
BgeeiQ61481.
CleanExiMM_PDE1A.
GenevestigatoriQ61481.

Interactioni

Subunit structurei

Homodimer By similarity.

Protein-protein interaction databases

IntActiQ61481. 2 interactions.
MINTiMINT-4106810.

Structurei

3D structure databases

ProteinModelPortaliQ61481.
SMRiQ61481. Positions 162-540.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni44 – 6421Calmodulin-bindingAdd
BLAST
Regioni213 – 535323Catalytic By similarityAdd
BLAST

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG139098.
HOGENOMiHOG000231888.
HOVERGENiHBG056120.
InParanoidiQ61481.
KOiK13755.

Family and domain databases

Gene3Di1.10.1300.10. 2 hits.
InterProiIPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
IPR013706. PDEase_N.
[Graphical view]
PfamiPF00233. PDEase_I. 1 hit.
PF08499. PDEase_I_N. 1 hit.
[Graphical view]
PRINTSiPR00387. PDIESTERASE1.
SMARTiSM00471. HDc. 1 hit.
[Graphical view]
PROSITEiPS00126. PDEASE_I. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform PDE1A2 (identifier: Q61481-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MCDSSPSSSH VWIAPVRNII MGSTDTDIEE LENATYKYLI GEQTEKMWQR    50
LKGILRCLVK QLEKGDVNVV DLKKNIEYAA SVLEAVYIDE TRRLLDTEDE 100
LSDIQTDSVP SEVRDWLAST FTRKMGMMKK KPEEKPKFRS IVHAVQAGIF 150
VERMYRKNYH MVGLTYPAAV IVTLKEVDKW SFDVFALNEA SGEHSLKFMI 200
YELFTRYDLI NRFKIPVSCL IAFAEALEVG YSKHKNPYHN LVHAADVTQT 250
VHYIMLHTGI MHWLTELEIL AMVFAAAIHD YEHTGTTNNF HIQTRSDVAI 300
LYNDRSVLEN HHVSAAYRLM QEEEMNILVN LSKDDWRDLR NLVIEMVLAT 350
DMSGHFQQIK NIRNSLQQPE GIDRAKTMSL ILHAADISHP AKTWKLHYRW 400
TMALMEEFFL QGDKEAELGL PFSPLCDRKS TMVAQSQIGF IDFIVEPTFS 450
LLTDSTEKIV IPLIEEASKS QSSNYGASSS STMIGFHVAD SLRRSNTKGS 500
VCDGSYAPDY SLSAVDLKSF KNNLVDIIQQ NKERWKELAA QGELDLHKNS 550
EELGNTEEKH ADTRP 565
Length:565
Mass (Da):64,529
Last modified:July 27, 2011 - v2
Checksum:i848103C73CC0FB7B
GO
Isoform PDE1A1 (identifier: Q61481-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MCDSSPSSSHVWIAPVRNIIMGSTDTDIEELENATYKYLIGEQTEKMWQRLKGI → MDEYVTIRKKHLQRPIFR

Show »
Length:529
Mass (Da):60,685
Checksum:iF7C02D4DF7B290E6
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5454MCDSS…RLKGI → MDEYVTIRKKHLQRPIFR in isoform PDE1A1. VSP_004551Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti2 – 32CD → VG in AAB03319. 1 Publication
Sequence conflicti6 – 61P → T in AAB03319. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U56649 mRNA. Translation: AAB03319.1.
AL844577 Genomic DNA. No translation available.
AL928607 Genomic DNA. No translation available.
AL928811 Genomic DNA. No translation available.
AF023529 mRNA. Translation: AAB81952.1.
RefSeqiXP_006498986.1. XM_006498923.1. [Q61481-2]
UniGeneiMm.40678.

Genome annotation databases

GeneIDi18573.
KEGGimmu:18573.
UCSCiuc008khd.2. mouse. [Q61481-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U56649 mRNA. Translation: AAB03319.1 .
AL844577 Genomic DNA. No translation available.
AL928607 Genomic DNA. No translation available.
AL928811 Genomic DNA. No translation available.
AF023529 mRNA. Translation: AAB81952.1 .
RefSeqi XP_006498986.1. XM_006498923.1. [Q61481-2 ]
UniGenei Mm.40678.

3D structure databases

ProteinModelPortali Q61481.
SMRi Q61481. Positions 162-540.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q61481. 2 interactions.
MINTi MINT-4106810.

PTM databases

PhosphoSitei Q61481.

Proteomic databases

MaxQBi Q61481.
PaxDbi Q61481.
PRIDEi Q61481.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 18573.
KEGGi mmu:18573.
UCSCi uc008khd.2. mouse. [Q61481-1 ]

Organism-specific databases

CTDi 5136.
MGIi MGI:1201792. Pde1a.

Phylogenomic databases

eggNOGi NOG139098.
HOGENOMi HOG000231888.
HOVERGENi HBG056120.
InParanoidi Q61481.
KOi K13755.

Enzyme and pathway databases

Reactomei REACT_227001. Cam-PDE 1 activation.

Miscellaneous databases

PROi Q61481.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q61481.
Bgeei Q61481.
CleanExi MM_PDE1A.
Genevestigatori Q61481.

Family and domain databases

Gene3Di 1.10.1300.10. 2 hits.
InterProi IPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
IPR013706. PDEase_N.
[Graphical view ]
Pfami PF00233. PDEase_I. 1 hit.
PF08499. PDEase_I_N. 1 hit.
[Graphical view ]
PRINTSi PR00387. PDIESTERASE1.
SMARTi SM00471. HDc. 1 hit.
[Graphical view ]
PROSITEi PS00126. PDEASE_I. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Yan C., Sonnenburg W.K., Zhao A.Z., Kwak K.S., Beavo J.A.
    Submitted (JUL-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE1A2).
    Strain: BALB/c.
    Tissue: Brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. Sonnenburg W.K., Rybalkin S.D., Bornfeldt K.E., Kwak K.S., Rybalkina I., Beavo J.A.
    Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-262 (ISOFORM PDE1A1).
    Tissue: Heart.

Entry informationi

Entry nameiPDE1A_MOUSE
AccessioniPrimary (citable) accession number: Q61481
Secondary accession number(s): E9Q6V1, O35388
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 27, 2011
Last modified: September 3, 2014
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi