Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q61481 (PDE1A_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 101. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A

Short name=Cam-PDE 1A
EC=3.1.4.17
Alternative name(s):
61 kDa Cam-PDE
Gene names
Name:Pde1a
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length565 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a higher affinity for cGMP than for cAMP By similarity.

Catalytic activity

Nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate.

Cofactor

Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions By similarity.

Enzyme regulation

Type I PDE are activated by the binding of calmodulin in the presence of Ca2+.

Subunit structure

Homodimer By similarity.

Sequence similarities

Belongs to the cyclic nucleotide phosphodiesterase family. PDE1 subfamily.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform PDE1A2 (identifier: Q61481-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform PDE1A1 (identifier: Q61481-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MCDSSPSSSHVWIAPVRNIIMGSTDTDIEELENATYKYLIGEQTEKMWQRLKGI → MDEYVTIRKKHLQRPIFR

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 565565Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A
PRO_0000198786

Regions

Region44 – 6421Calmodulin-binding
Region213 – 535323Catalytic By similarity

Sites

Active site2391Proton donor By similarity
Metal binding2431Divalent metal cation 1 By similarity
Metal binding2791Divalent metal cation 1 By similarity
Metal binding2801Divalent metal cation 1 By similarity
Metal binding2801Divalent metal cation 2 By similarity
Metal binding3861Divalent metal cation 1 By similarity

Natural variations

Alternative sequence1 – 5454MCDSS…RLKGI → MDEYVTIRKKHLQRPIFR in isoform PDE1A1.
VSP_004551

Experimental info

Sequence conflict2 – 32CD → VG in AAB03319. Ref.1
Sequence conflict61P → T in AAB03319. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform PDE1A2 [UniParc].

Last modified July 27, 2011. Version 2.
Checksum: 848103C73CC0FB7B

FASTA56564,529
        10         20         30         40         50         60 
MCDSSPSSSH VWIAPVRNII MGSTDTDIEE LENATYKYLI GEQTEKMWQR LKGILRCLVK 

        70         80         90        100        110        120 
QLEKGDVNVV DLKKNIEYAA SVLEAVYIDE TRRLLDTEDE LSDIQTDSVP SEVRDWLAST 

       130        140        150        160        170        180 
FTRKMGMMKK KPEEKPKFRS IVHAVQAGIF VERMYRKNYH MVGLTYPAAV IVTLKEVDKW 

       190        200        210        220        230        240 
SFDVFALNEA SGEHSLKFMI YELFTRYDLI NRFKIPVSCL IAFAEALEVG YSKHKNPYHN 

       250        260        270        280        290        300 
LVHAADVTQT VHYIMLHTGI MHWLTELEIL AMVFAAAIHD YEHTGTTNNF HIQTRSDVAI 

       310        320        330        340        350        360 
LYNDRSVLEN HHVSAAYRLM QEEEMNILVN LSKDDWRDLR NLVIEMVLAT DMSGHFQQIK 

       370        380        390        400        410        420 
NIRNSLQQPE GIDRAKTMSL ILHAADISHP AKTWKLHYRW TMALMEEFFL QGDKEAELGL 

       430        440        450        460        470        480 
PFSPLCDRKS TMVAQSQIGF IDFIVEPTFS LLTDSTEKIV IPLIEEASKS QSSNYGASSS 

       490        500        510        520        530        540 
STMIGFHVAD SLRRSNTKGS VCDGSYAPDY SLSAVDLKSF KNNLVDIIQQ NKERWKELAA 

       550        560 
QGELDLHKNS EELGNTEEKH ADTRP 

« Hide

Isoform PDE1A1 [UniParc].

Checksum: F7C02D4DF7B290E6
Show »

FASTA52960,685

References

« Hide 'large scale' references
[1]Yan C., Sonnenburg W.K., Zhao A.Z., Kwak K.S., Beavo J.A.
Submitted (JUL-1996) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE1A2).
Strain: BALB/c.
Tissue: Brain.
[2]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[3]Sonnenburg W.K., Rybalkin S.D., Bornfeldt K.E., Kwak K.S., Rybalkina I., Beavo J.A.
Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-262 (ISOFORM PDE1A1).
Tissue: Heart.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U56649 mRNA. Translation: AAB03319.1.
AL844577 Genomic DNA. No translation available.
AL928607 Genomic DNA. No translation available.
AL928811 Genomic DNA. No translation available.
AF023529 mRNA. Translation: AAB81952.1.
RefSeqXP_006498986.1. XM_006498923.1.
UniGeneMm.40678.

3D structure databases

ProteinModelPortalQ61481.
SMRQ61481. Positions 92-540.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ61481. 2 interactions.
MINTMINT-4106810.

PTM databases

PhosphoSiteQ61481.

Proteomic databases

PaxDbQ61481.
PRIDEQ61481.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID18573.
UCSCuc008khd.2. mouse. [Q61481-1]

Organism-specific databases

MGIMGI:1201792. Pde1a.

Phylogenomic databases

eggNOGNOG139098.
HOGENOMHOG000231888.
HOVERGENHBG056120.
InParanoidQ61481.

Gene expression databases

ArrayExpressQ61481.
BgeeQ61481.
CleanExMM_PDE1A.
GenevestigatorQ61481.

Family and domain databases

Gene3D1.10.1300.10. 2 hits.
InterProIPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
IPR013706. PDEase_N.
[Graphical view]
PfamPF00233. PDEase_I. 1 hit.
PF08499. PDEase_I_N. 1 hit.
[Graphical view]
PRINTSPR00387. PDIESTERASE1.
SMARTSM00471. HDc. 1 hit.
[Graphical view]
PROSITEPS00126. PDEASE_I. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

PROQ61481.
SOURCESearch...

Entry information

Entry namePDE1A_MOUSE
AccessionPrimary (citable) accession number: Q61481
Secondary accession number(s): E9Q6V1, O35388
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 27, 2011
Last modified: March 19, 2014
This is version 101 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot