Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q61481

- PDE1A_MOUSE

UniProt

Q61481 - PDE1A_MOUSE

Protein

Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A

Gene

Pde1a

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 105 (01 Oct 2014)
      Sequence version 2 (27 Jul 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a higher affinity for cGMP than for cAMP By similarity.By similarity

    Catalytic activityi

    Nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate.

    Cofactori

    Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions By similarity.By similarity

    Enzyme regulationi

    Type I PDE are activated by the binding of calmodulin in the presence of Ca2+.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei239 – 2391Proton donorBy similarity
    Metal bindingi243 – 2431Divalent metal cation 1By similarity
    Metal bindingi279 – 2791Divalent metal cation 1By similarity
    Metal bindingi280 – 2801Divalent metal cation 1By similarity
    Metal bindingi280 – 2801Divalent metal cation 2By similarity
    Metal bindingi386 – 3861Divalent metal cation 1By similarity

    GO - Molecular functioni

    1. 3',5'-cyclic-AMP phosphodiesterase activity Source: Ensembl
    2. calcium- and calmodulin-regulated 3',5'-cyclic-GMP phosphodiesterase activity Source: MGI
    3. calmodulin-dependent cyclic-nucleotide phosphodiesterase activity Source: MGI
    4. cGMP binding Source: Ensembl
    5. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. cAMP catabolic process Source: Ensembl
    2. cGMP catabolic process Source: Ensembl
    3. regulation of smooth muscle cell apoptotic process Source: Ensembl
    4. regulation of smooth muscle cell proliferation Source: Ensembl
    5. signal transduction Source: InterPro

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Ligandi

    Calmodulin-binding, cAMP, cGMP, Metal-binding

    Enzyme and pathway databases

    ReactomeiREACT_227001. Cam-PDE 1 activation.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A (EC:3.1.4.17)
    Short name:
    Cam-PDE 1A
    Alternative name(s):
    61 kDa Cam-PDE
    Gene namesi
    Name:Pde1a
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Unplaced

    Organism-specific databases

    MGIiMGI:1201792. Pde1a.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: Ensembl
    2. neuronal cell body Source: Ensembl
    3. nucleus Source: Ensembl

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 565565Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1APRO_0000198786Add
    BLAST

    Proteomic databases

    MaxQBiQ61481.
    PaxDbiQ61481.
    PRIDEiQ61481.

    PTM databases

    PhosphoSiteiQ61481.

    Expressioni

    Gene expression databases

    ArrayExpressiQ61481.
    BgeeiQ61481.
    CleanExiMM_PDE1A.
    GenevestigatoriQ61481.

    Interactioni

    Subunit structurei

    Homodimer.By similarity

    Protein-protein interaction databases

    IntActiQ61481. 2 interactions.
    MINTiMINT-4106810.

    Structurei

    3D structure databases

    ProteinModelPortaliQ61481.
    SMRiQ61481. Positions 162-540.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni44 – 6421Calmodulin-bindingAdd
    BLAST
    Regioni213 – 535323CatalyticBy similarityAdd
    BLAST

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiNOG139098.
    HOGENOMiHOG000231888.
    HOVERGENiHBG056120.
    InParanoidiQ61481.
    KOiK13755.

    Family and domain databases

    Gene3Di1.10.1300.10. 2 hits.
    InterProiIPR003607. HD/PDEase_dom.
    IPR023088. PDEase.
    IPR002073. PDEase_catalytic_dom.
    IPR023174. PDEase_CS.
    IPR013706. PDEase_N.
    [Graphical view]
    PfamiPF00233. PDEase_I. 1 hit.
    PF08499. PDEase_I_N. 1 hit.
    [Graphical view]
    PRINTSiPR00387. PDIESTERASE1.
    SMARTiSM00471. HDc. 1 hit.
    [Graphical view]
    PROSITEiPS00126. PDEASE_I. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform PDE1A2 (identifier: Q61481-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MCDSSPSSSH VWIAPVRNII MGSTDTDIEE LENATYKYLI GEQTEKMWQR    50
    LKGILRCLVK QLEKGDVNVV DLKKNIEYAA SVLEAVYIDE TRRLLDTEDE 100
    LSDIQTDSVP SEVRDWLAST FTRKMGMMKK KPEEKPKFRS IVHAVQAGIF 150
    VERMYRKNYH MVGLTYPAAV IVTLKEVDKW SFDVFALNEA SGEHSLKFMI 200
    YELFTRYDLI NRFKIPVSCL IAFAEALEVG YSKHKNPYHN LVHAADVTQT 250
    VHYIMLHTGI MHWLTELEIL AMVFAAAIHD YEHTGTTNNF HIQTRSDVAI 300
    LYNDRSVLEN HHVSAAYRLM QEEEMNILVN LSKDDWRDLR NLVIEMVLAT 350
    DMSGHFQQIK NIRNSLQQPE GIDRAKTMSL ILHAADISHP AKTWKLHYRW 400
    TMALMEEFFL QGDKEAELGL PFSPLCDRKS TMVAQSQIGF IDFIVEPTFS 450
    LLTDSTEKIV IPLIEEASKS QSSNYGASSS STMIGFHVAD SLRRSNTKGS 500
    VCDGSYAPDY SLSAVDLKSF KNNLVDIIQQ NKERWKELAA QGELDLHKNS 550
    EELGNTEEKH ADTRP 565
    Length:565
    Mass (Da):64,529
    Last modified:July 27, 2011 - v2
    Checksum:i848103C73CC0FB7B
    GO
    Isoform PDE1A1 (identifier: Q61481-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-54: MCDSSPSSSHVWIAPVRNIIMGSTDTDIEELENATYKYLIGEQTEKMWQRLKGI → MDEYVTIRKKHLQRPIFR

    Show »
    Length:529
    Mass (Da):60,685
    Checksum:iF7C02D4DF7B290E6
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti2 – 32CD → VG in AAB03319. 1 PublicationCurated
    Sequence conflicti6 – 61P → T in AAB03319. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5454MCDSS…RLKGI → MDEYVTIRKKHLQRPIFR in isoform PDE1A1. 1 PublicationVSP_004551Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U56649 mRNA. Translation: AAB03319.1.
    AL844577 Genomic DNA. No translation available.
    AL928607 Genomic DNA. No translation available.
    AL928811 Genomic DNA. No translation available.
    AF023529 mRNA. Translation: AAB81952.1.
    RefSeqiXP_006498986.1. XM_006498923.1. [Q61481-2]
    UniGeneiMm.40678.

    Genome annotation databases

    GeneIDi18573.
    KEGGimmu:18573.
    UCSCiuc008khd.2. mouse. [Q61481-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U56649 mRNA. Translation: AAB03319.1 .
    AL844577 Genomic DNA. No translation available.
    AL928607 Genomic DNA. No translation available.
    AL928811 Genomic DNA. No translation available.
    AF023529 mRNA. Translation: AAB81952.1 .
    RefSeqi XP_006498986.1. XM_006498923.1. [Q61481-2 ]
    UniGenei Mm.40678.

    3D structure databases

    ProteinModelPortali Q61481.
    SMRi Q61481. Positions 162-540.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q61481. 2 interactions.
    MINTi MINT-4106810.

    PTM databases

    PhosphoSitei Q61481.

    Proteomic databases

    MaxQBi Q61481.
    PaxDbi Q61481.
    PRIDEi Q61481.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 18573.
    KEGGi mmu:18573.
    UCSCi uc008khd.2. mouse. [Q61481-1 ]

    Organism-specific databases

    CTDi 5136.
    MGIi MGI:1201792. Pde1a.

    Phylogenomic databases

    eggNOGi NOG139098.
    HOGENOMi HOG000231888.
    HOVERGENi HBG056120.
    InParanoidi Q61481.
    KOi K13755.

    Enzyme and pathway databases

    Reactomei REACT_227001. Cam-PDE 1 activation.

    Miscellaneous databases

    PROi Q61481.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q61481.
    Bgeei Q61481.
    CleanExi MM_PDE1A.
    Genevestigatori Q61481.

    Family and domain databases

    Gene3Di 1.10.1300.10. 2 hits.
    InterProi IPR003607. HD/PDEase_dom.
    IPR023088. PDEase.
    IPR002073. PDEase_catalytic_dom.
    IPR023174. PDEase_CS.
    IPR013706. PDEase_N.
    [Graphical view ]
    Pfami PF00233. PDEase_I. 1 hit.
    PF08499. PDEase_I_N. 1 hit.
    [Graphical view ]
    PRINTSi PR00387. PDIESTERASE1.
    SMARTi SM00471. HDc. 1 hit.
    [Graphical view ]
    PROSITEi PS00126. PDEASE_I. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Yan C., Sonnenburg W.K., Zhao A.Z., Kwak K.S., Beavo J.A.
      Submitted (JUL-1996) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE1A2).
      Strain: BALB/c.
      Tissue: Brain.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    3. Sonnenburg W.K., Rybalkin S.D., Bornfeldt K.E., Kwak K.S., Rybalkina I., Beavo J.A.
      Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-262 (ISOFORM PDE1A1).
      Tissue: Heart.

    Entry informationi

    Entry nameiPDE1A_MOUSE
    AccessioniPrimary (citable) accession number: Q61481
    Secondary accession number(s): E9Q6V1, O35388
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1998
    Last sequence update: July 27, 2011
    Last modified: October 1, 2014
    This is version 105 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3