Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A

Gene

Pde1a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a higher affinity for cGMP than for cAMP (By similarity).By similarity

Catalytic activityi

Nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate.

Cofactori

a divalent metal cationBy similarityNote: Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.By similarity

Enzyme regulationi

Type I PDE are activated by the binding of calmodulin in the presence of Ca2+.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei239 – 2391Proton donorBy similarity
Metal bindingi243 – 2431Divalent metal cation 1By similarity
Metal bindingi279 – 2791Divalent metal cation 1By similarity
Metal bindingi280 – 2801Divalent metal cation 1By similarity
Metal bindingi280 – 2801Divalent metal cation 2By similarity
Metal bindingi386 – 3861Divalent metal cation 1By similarity

GO - Molecular functioni

  1. 3',5'-cyclic-AMP phosphodiesterase activity Source: Ensembl
  2. calcium- and calmodulin-regulated 3',5'-cyclic-GMP phosphodiesterase activity Source: MGI
  3. calmodulin-dependent cyclic-nucleotide phosphodiesterase activity Source: MGI
  4. cGMP binding Source: Ensembl
  5. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. cAMP catabolic process Source: Ensembl
  2. cGMP catabolic process Source: Ensembl
  3. regulation of smooth muscle cell apoptotic process Source: Ensembl
  4. regulation of smooth muscle cell proliferation Source: Ensembl
  5. signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

Calmodulin-binding, cAMP, cGMP, Metal-binding

Enzyme and pathway databases

BRENDAi3.1.4.17. 3474.
ReactomeiREACT_309030. Cam-PDE 1 activation.
REACT_311531. cGMP effects.
REACT_313192. G alpha (s) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A (EC:3.1.4.17)
Short name:
Cam-PDE 1A
Alternative name(s):
61 kDa Cam-PDE
Gene namesi
Name:Pde1a
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1201792. Pde1a.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: Ensembl
  2. neuronal cell body Source: Ensembl
  3. nucleus Source: Ensembl
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 565565Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1APRO_0000198786Add
BLAST

Proteomic databases

MaxQBiQ61481.
PaxDbiQ61481.
PRIDEiQ61481.

PTM databases

PhosphoSiteiQ61481.

Expressioni

Gene expression databases

BgeeiQ61481.
CleanExiMM_PDE1A.
ExpressionAtlasiQ61481. baseline and differential.
GenevestigatoriQ61481.

Interactioni

Subunit structurei

Homodimer.By similarity

Protein-protein interaction databases

IntActiQ61481. 2 interactions.
MINTiMINT-4106810.

Structurei

3D structure databases

ProteinModelPortaliQ61481.
SMRiQ61481. Positions 166-540.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni44 – 6421Calmodulin-bindingAdd
BLAST
Regioni213 – 535323CatalyticBy similarityAdd
BLAST

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG139098.
HOGENOMiHOG000231888.
HOVERGENiHBG056120.
InParanoidiQ61481.
KOiK13755.

Family and domain databases

Gene3Di1.10.1300.10. 2 hits.
InterProiIPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
IPR013706. PDEase_N.
[Graphical view]
PfamiPF00233. PDEase_I. 1 hit.
PF08499. PDEase_I_N. 1 hit.
[Graphical view]
PRINTSiPR00387. PDIESTERASE1.
SMARTiSM00471. HDc. 1 hit.
[Graphical view]
PROSITEiPS00126. PDEASE_I. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform PDE1A2 (identifier: Q61481-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MCDSSPSSSH VWIAPVRNII MGSTDTDIEE LENATYKYLI GEQTEKMWQR
60 70 80 90 100
LKGILRCLVK QLEKGDVNVV DLKKNIEYAA SVLEAVYIDE TRRLLDTEDE
110 120 130 140 150
LSDIQTDSVP SEVRDWLAST FTRKMGMMKK KPEEKPKFRS IVHAVQAGIF
160 170 180 190 200
VERMYRKNYH MVGLTYPAAV IVTLKEVDKW SFDVFALNEA SGEHSLKFMI
210 220 230 240 250
YELFTRYDLI NRFKIPVSCL IAFAEALEVG YSKHKNPYHN LVHAADVTQT
260 270 280 290 300
VHYIMLHTGI MHWLTELEIL AMVFAAAIHD YEHTGTTNNF HIQTRSDVAI
310 320 330 340 350
LYNDRSVLEN HHVSAAYRLM QEEEMNILVN LSKDDWRDLR NLVIEMVLAT
360 370 380 390 400
DMSGHFQQIK NIRNSLQQPE GIDRAKTMSL ILHAADISHP AKTWKLHYRW
410 420 430 440 450
TMALMEEFFL QGDKEAELGL PFSPLCDRKS TMVAQSQIGF IDFIVEPTFS
460 470 480 490 500
LLTDSTEKIV IPLIEEASKS QSSNYGASSS STMIGFHVAD SLRRSNTKGS
510 520 530 540 550
VCDGSYAPDY SLSAVDLKSF KNNLVDIIQQ NKERWKELAA QGELDLHKNS
560
EELGNTEEKH ADTRP
Length:565
Mass (Da):64,529
Last modified:July 27, 2011 - v2
Checksum:i848103C73CC0FB7B
GO
Isoform PDE1A1 (identifier: Q61481-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MCDSSPSSSHVWIAPVRNIIMGSTDTDIEELENATYKYLIGEQTEKMWQRLKGI → MDEYVTIRKKHLQRPIFR

Show »
Length:529
Mass (Da):60,685
Checksum:iF7C02D4DF7B290E6
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti2 – 32CD → VG in AAB03319 (Ref. 1) Curated
Sequence conflicti6 – 61P → T in AAB03319 (Ref. 1) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5454MCDSS…RLKGI → MDEYVTIRKKHLQRPIFR in isoform PDE1A1. 1 PublicationVSP_004551Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U56649 mRNA. Translation: AAB03319.1.
AL844577 Genomic DNA. No translation available.
AL928607 Genomic DNA. No translation available.
AL928811 Genomic DNA. No translation available.
AF023529 mRNA. Translation: AAB81952.1.
RefSeqiXP_006498986.1. XM_006498923.2. [Q61481-2]
UniGeneiMm.40678.

Genome annotation databases

GeneIDi18573.
KEGGimmu:18573.
UCSCiuc008khd.2. mouse. [Q61481-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U56649 mRNA. Translation: AAB03319.1.
AL844577 Genomic DNA. No translation available.
AL928607 Genomic DNA. No translation available.
AL928811 Genomic DNA. No translation available.
AF023529 mRNA. Translation: AAB81952.1.
RefSeqiXP_006498986.1. XM_006498923.2. [Q61481-2]
UniGeneiMm.40678.

3D structure databases

ProteinModelPortaliQ61481.
SMRiQ61481. Positions 166-540.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ61481. 2 interactions.
MINTiMINT-4106810.

PTM databases

PhosphoSiteiQ61481.

Proteomic databases

MaxQBiQ61481.
PaxDbiQ61481.
PRIDEiQ61481.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi18573.
KEGGimmu:18573.
UCSCiuc008khd.2. mouse. [Q61481-1]

Organism-specific databases

CTDi5136.
MGIiMGI:1201792. Pde1a.

Phylogenomic databases

eggNOGiNOG139098.
HOGENOMiHOG000231888.
HOVERGENiHBG056120.
InParanoidiQ61481.
KOiK13755.

Enzyme and pathway databases

BRENDAi3.1.4.17. 3474.
ReactomeiREACT_309030. Cam-PDE 1 activation.
REACT_311531. cGMP effects.
REACT_313192. G alpha (s) signalling events.

Miscellaneous databases

PROiQ61481.
SOURCEiSearch...

Gene expression databases

BgeeiQ61481.
CleanExiMM_PDE1A.
ExpressionAtlasiQ61481. baseline and differential.
GenevestigatoriQ61481.

Family and domain databases

Gene3Di1.10.1300.10. 2 hits.
InterProiIPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
IPR013706. PDEase_N.
[Graphical view]
PfamiPF00233. PDEase_I. 1 hit.
PF08499. PDEase_I_N. 1 hit.
[Graphical view]
PRINTSiPR00387. PDIESTERASE1.
SMARTiSM00471. HDc. 1 hit.
[Graphical view]
PROSITEiPS00126. PDEASE_I. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Yan C., Sonnenburg W.K., Zhao A.Z., Kwak K.S., Beavo J.A.
    Submitted (JUN-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE1A2).
    Strain: BALB/c.
    Tissue: Brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. Sonnenburg W.K., Rybalkin S.D., Bornfeldt K.E., Kwak K.S., Rybalkina I., Beavo J.A.
    Submitted (SEP-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-262 (ISOFORM PDE1A1).
    Tissue: Heart.

Entry informationi

Entry nameiPDE1A_MOUSE
AccessioniPrimary (citable) accession number: Q61481
Secondary accession number(s): E9Q6V1, O35388
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 27, 2011
Last modified: April 1, 2015
This is version 110 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.