Reviewed,
UniProtKB/Swiss-Prot Q61481 (PDE1A_MOUSE)
Last modified
October 13, 2009.
Version 63.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A Short name=Cam-PDE 1A EC=3.1.4.17 Alternative name(s): 61 kDa Cam-PDE | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 565 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Has a higher affinity for cGMP than for cAMP. |
| Catalytic activity | Nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate. |
| Enzyme regulation | Type I PDE are activated by the binding of calmodulin in the presence of Ca2+. |
| Subunit structure | Homodimer By similarity. |
| Sequence similarities | Belongs to the cyclic nucleotide phosphodiesterase family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | Calmodulin-binding cAMP cGMP |
| Molecular function | Hydrolase |
| Gene Ontology (GO) | |
| Biological process | signal transduction Inferred from electronic annotation. Source: InterPro |
| Molecular function | 3',5'-cyclic-nucleotide phosphodiesterase activity Inferred from electronic annotation. Source: EC calmodulin bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform PDE1A2 (identifier: Q61481-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform PDE1A1 (identifier: Q61481-2) The sequence of this isoform differs from the canonical sequence as follows: 1-54: MVGSSTSSSHVWIAPVRNIIMGSTDTDIEELENATYKYLIGEQTEKMWQRLKGI → MDEYVTIRKKHLQRPIFR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 565 | 565 | Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A | PRO_0000198786 | |||||
Regions | |||||||||
| Region | 44 – 64 | 21 | Calmodulin-binding | ||||||
| Region | 213 – 535 | 323 | Catalytic By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 54 | 54 | MVGSS…RLKGI → MDEYVTIRKKHLQRPIFR in isoform PDE1A1. | VSP_004551 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | Yan C., Sonnenburg W.K., Zhao A.Z., Kwak K.S., Beavo J.A. Submitted (JUL-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE1A2). Strain: BALB/c. Tissue: Brain. |
| [2] | Sonnenburg W.K., Rybalkin S.D., Bornfeldt K.E., Kwak K.S., Rybalkina I., Beavo J.A. Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-262 (ISOFORM PDE1A1). Tissue: Heart. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| U56649 mRNA. Translation: AAB03319.1. AF023529 mRNA. Translation: AAB81952.1. | |
| IPI | IPI00121336. IPI00223497. |
| UniGene | Mm.40678 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1OYN based on UniProtKB Q08499. |
| SMR | Q61481. Positions 162-491. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q61481. |
PTM databases | |
| PhosphoSite | Q61481. |
Proteomic databases | |
| PRIDE | Q61481. |
Genome annotation databases | |
| Ensembl | ENSMUST00000102653; ENSMUSP00000099713; ENSMUSG00000059173; Mus musculus. [Genome view] ENSMUST00000102654; ENSMUSP00000099714; ENSMUSG00000059173; Mus musculus. [Genome view] ENSMUST00000102655; ENSMUSP00000099715; ENSMUSG00000059173; Mus musculus. [Genome view] |
Organism-specific databases | |
| MGI | MGI:1201792. Pde1a. |
Phylogenomic databases | |
| HOGENOM | Q61481. |
| HOVERGEN | Q61481. |
Enzyme and pathway databases | |
| BRENDA | 3.1.4.17. 244. |
Gene expression databases | |
| ArrayExpress | Q61481. |
| Bgee | Q61481. |
| CleanEx | MM_PDE1A. |
| Genevestigator | Q61481. |
| GermOnline | ENSMUSG00000059173. Mus musculus. |
Family and domain databases | |
| InterPro | IPR003607. Met-dep_phosphohydro_HD. IPR002073. PDEase. IPR013706. PDEase_N. [Graphical view] |
| Pfam | PF00233. PDEase_I. 1 hit. PF08499. PDEase_I_N. 1 hit. [Graphical view] |
| PRINTS | PR00387. PDIESTERASE1. |
| SMART | SM00471. HDc. 1 hit. [Graphical view] |
| PROSITE | PS00126. PDEASE_I. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| SOURCE | Search... |
Entry information
| Entry name | PDE1A_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q61481 Secondary accession number(s): O35388 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


