Q61481 (PDE1A_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 93.
History...
Clusters with 
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A Short name=Cam-PDE 1A EC=3.1.4.17 Alternative name(s): 61 kDa Cam-PDE | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 565 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a higher affinity for cGMP than for cAMP By similarity. |
| Catalytic activity | Nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate. |
| Cofactor | Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions By similarity. |
| Enzyme regulation | Type I PDE are activated by the binding of calmodulin in the presence of Ca2+. |
| Subunit structure | Homodimer By similarity. |
| Sequence similarities | Belongs to the cyclic nucleotide phosphodiesterase family. PDE1 subfamily. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | Calmodulin-binding Metal-binding cAMP cGMP |
| Molecular function | Hydrolase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | signal transduction Inferred from electronic annotation. Source: InterPro |
| Molecular_function | calcium- and calmodulin-regulated 3',5'-cyclic-GMP phosphodiesterase activity Inferred from sequence orthology PubMed 7568196. Source: MGI calmodulin-dependent cyclic-nucleotide phosphodiesterase activityInferred from sequence orthology PubMed 7568196. Source: MGI metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform PDE1A2 (identifier: Q61481-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform PDE1A1 (identifier: Q61481-2) The sequence of this isoform differs from the canonical sequence as follows: 1-54: MCDSSPSSSHVWIAPVRNIIMGSTDTDIEELENATYKYLIGEQTEKMWQRLKGI → MDEYVTIRKKHLQRPIFR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 565 | 565 | Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A | PRO_0000198786 | |||||
Regions | |||||||||
| Region | 44 – 64 | 21 | Calmodulin-binding | ||||||
| Region | 213 – 535 | 323 | Catalytic By similarity | ||||||
Sites | |||||||||
| Active site | 239 | 1 | Proton donor By similarity | ||||||
| Metal binding | 243 | 1 | Divalent metal cation 1 By similarity | ||||||
| Metal binding | 279 | 1 | Divalent metal cation 1 By similarity | ||||||
| Metal binding | 280 | 1 | Divalent metal cation 1 By similarity | ||||||
| Metal binding | 280 | 1 | Divalent metal cation 2 By similarity | ||||||
| Metal binding | 386 | 1 | Divalent metal cation 1 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 54 | 54 | MCDSS…RLKGI → MDEYVTIRKKHLQRPIFR in isoform PDE1A1. | VSP_004551 | |||||
Experimental info | |||||||||
| Sequence conflict | 2 – 3 | 2 | CD → VG in AAB03319. Ref.1 | ||||||
| Sequence conflict | 6 | 1 | P → T in AAB03319. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Yan C., Sonnenburg W.K., Zhao A.Z., Kwak K.S., Beavo J.A. Submitted (JUL-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE1A2). Strain: BALB/c. Tissue: Brain. |
| [2] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S.  Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [3] | Sonnenburg W.K., Rybalkin S.D., Bornfeldt K.E., Kwak K.S., Rybalkina I., Beavo J.A. Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-262 (ISOFORM PDE1A1). Tissue: Heart. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U56649 mRNA. Translation: AAB03319.1. AL844577 Genomic DNA. No translation available. AL928607 Genomic DNA. No translation available. AL928811 Genomic DNA. No translation available. AF023529 mRNA. Translation: AAB81952.1. |
| IPI | IPI00121336. IPI00874497. |
| UniGene | Mm.40678. |
3D structure databases | |
| ProteinModelPortal | Q61481. |
| SMR | Q61481. Positions 162-540. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q61481. 1 interaction. |
PTM databases | |
| PhosphoSite | Q61481. |
Proteomic databases | |
| PaxDb | Q61481. |
| PRIDE | Q61481. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Organism-specific databases | |
| MGI | MGI:1201792. Pde1a. |
Phylogenomic databases | |
| eggNOG | NOG139098. |
| HOGENOM | HOG000231888. |
| HOVERGEN | HBG056120. |
| InParanoid | Q61481. |
| OrthoDB | EOG4NZTSR. |
Gene expression databases | |
| ArrayExpress | Q61481. |
| Bgee | Q61481. |
| CleanEx | MM_PDE1A. |
| Genevestigator | Q61481. |
| GermOnline | ENSMUSG00000059173. Mus musculus. |
Family and domain databases | |
| Gene3D | 1.10.1300.10. 2 hits. |
| InterPro | IPR003607. HD/PDEase_dom. IPR023088. PDEase. IPR002073. PDEase_catalytic_dom. IPR023174. PDEase_CS. IPR013706. PDEase_N. [Graphical view] |
| Pfam | PF00233. PDEase_I. 1 hit. PF08499. PDEase_I_N. 1 hit. [Graphical view] |
| PRINTS | PR00387. PDIESTERASE1. |
| SMART | SM00471. HDc. 1 hit. [Graphical view] |
| PROSITE | PS00126. PDEASE_I. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| SOURCE | Search... |
Entry information
| Entry name | PDE1A_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q61481 Secondary accession number(s): E9Q6V1, O35388 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |