SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q61411

- RASH_MOUSE

UniProt

Q61411 - RASH_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

GTPase HRas

Gene
Hras, Hras1
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.

Enzyme regulationi

Alternates between an inactive form bound to GDP and an active form bound to GTP. Activated by a guanine nucleotide-exchange factor (GEF) and inactivated by a GTPase-activating protein (GAP).

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi10 – 178GTP By similarity
Nucleotide bindingi57 – 615GTP By similarity
Nucleotide bindingi116 – 1194GTP By similarity

GO - Molecular functioni

  1. GTP binding Source: MGI
  2. protein binding Source: IntAct

GO - Biological processi

  1. cell aging Source: MGI
  2. cell cycle arrest Source: Ensembl
  3. cell proliferation Source: MGI
  4. cellular senescence Source: Ensembl
  5. endocytosis Source: MGI
  6. GTP catabolic process Source: InterPro
  7. intrinsic apoptotic signaling pathway Source: MGI
  8. mitotic cell cycle checkpoint Source: Ensembl
  9. negative regulation of cell proliferation Source: Ensembl
  10. negative regulation of gene expression Source: Ensembl
  11. negative regulation of neuron apoptotic process Source: MGI
  12. negative regulation of Rho GTPase activity Source: Ensembl
  13. positive regulation of actin cytoskeleton reorganization Source: Ensembl
  14. positive regulation of cell migration Source: Ensembl
  15. positive regulation of cell proliferation Source: MGI
  16. positive regulation of DNA replication Source: Ensembl
  17. positive regulation of epithelial cell proliferation Source: Ensembl
  18. positive regulation of ERK1 and ERK2 cascade Source: Ensembl
  19. positive regulation of gene expression Source: MGI
  20. positive regulation of JNK cascade Source: Ensembl
  21. positive regulation of MAP kinase activity Source: Ensembl
  22. positive regulation of miRNA metabolic process Source: Ensembl
  23. positive regulation of Rac GTPase activity Source: Ensembl
  24. positive regulation of Ras protein signal transduction Source: MGI
  25. positive regulation of ruffle assembly Source: Ensembl
  26. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
  27. positive regulation of wound healing Source: Ensembl
  28. protein heterooligomerization Source: Ensembl
  29. Ras protein signal transduction Source: MGI
  30. regulation of long-term neuronal synaptic plasticity Source: MGI
  31. small GTPase mediated signal transduction Source: MGI
  32. social behavior Source: Ensembl
Complete GO annotation...

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_188185. DAP12 signaling.
REACT_188528. GRB2 events in ERBB2 signaling.
REACT_188530. FCERI mediated MAPK activation.
REACT_188574. SHC1 events in ERBB2 signaling.
REACT_188578. Signaling by SCF-KIT.
REACT_188580. SHC1 events in ERBB4 signaling.
REACT_196455. Signaling by FGFR mutants.
REACT_198244. Ras activation uopn Ca2+ infux through NMDA receptor.
REACT_198350. EGFR Transactivation by Gastrin.
REACT_199122. Activation of RAS in B cells.
REACT_199123. Signaling by constitutively active EGFR.
REACT_207601. p38MAPK events.
REACT_210793. Interleukin receptor SHC signaling.
REACT_211860. Tie2 Signaling.
REACT_94437. SHC-mediated cascade.

Names & Taxonomyi

Protein namesi
Recommended name:
GTPase HRas
Alternative name(s):
H-Ras-1
Transforming protein p21
c-H-ras
p21ras
Cleaved into the following chain:
Gene namesi
Name:Hras
Synonyms:Hras1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 7

Organism-specific databases

MGIiMGI:96224. Hras.

Subcellular locationi

Cell membrane By similarity. Cell membrane; Lipid-anchor; Cytoplasmic side By similarity. Golgi apparatus By similarity. Golgi apparatus membrane; Lipid-anchor By similarity
Note: Shuttles between the plasma membrane and the Golgi apparatus. The active GTP-bound form is localized most strongly to membranes than the inactive GDP-bound form By similarity.

GO - Cellular componenti

  1. Golgi apparatus Source: UniProtKB
  2. Golgi membrane Source: UniProtKB-SubCell
  3. plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi61 – 611Q → R: Found in chemically induced liver tumors. 1 Publication

Keywords - Diseasei

Proto-oncogene

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 186186GTPase HRasPRO_0000042998Add
BLAST
Initiator methioninei1 – 11Removed; alternate By similarity
Chaini2 – 186185GTPase HRas, N-terminally processedPRO_0000326478Add
BLAST
Propeptidei187 – 1893Removed in mature form By similarityPRO_0000042999

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine By similarity
Modified residuei2 – 21N-acetylthreonine; in GTPase HRas, N-terminally processed By similarity
Modified residuei118 – 1181S-nitrosocysteine By similarity
Lipidationi181 – 1811S-palmitoyl cysteine By similarity
Lipidationi184 – 1841S-(15-deoxy-Delta12,14-prostaglandin J2-9-yl)cysteine; alternate By similarity
Lipidationi184 – 1841S-palmitoyl cysteine; alternate By similarity
Modified residuei186 – 1861Cysteine methyl ester By similarity
Lipidationi186 – 1861S-farnesyl cysteine By similarity

Post-translational modificationi

Palmitoylated by the ZDHHC9-GOLGA7 complex. A continuous cycle of de- and re-palmitoylation regulates rapid exchange between plasma membrane and Golgi By similarity.
S-nitrosylated; critical for redox regulation. Important for stimulating guanine nucleotide exchange. No structural perturbation on nitrosylation.
The covalent modification of cysteine by 15-deoxy-Delta12,14-prostaglandin-J2 is autocatalytic and reversible. It may occur as an alternative to other cysteine modifications, such as S-nitrosylation and S-palmitoylation By similarity.
Acetylation at Lys-104 prevents interaction with guanine nucleotide exchange factors (GEFs) By similarity.

Keywords - PTMi

Acetylation, Lipoprotein, Methylation, Palmitate, Prenylation, S-nitrosylation

Proteomic databases

MaxQBiQ61411.
PaxDbiQ61411.
PRIDEiQ61411.

PTM databases

PhosphoSiteiQ61411.

Expressioni

Gene expression databases

ArrayExpressiQ61411.
BgeeiQ61411.
CleanExiMM_HRAS1.
GenevestigatoriQ61411.

Interactioni

Subunit structurei

Forms a signaling complex with RASGRP1 and DGKZ. In its GTP-bound form interacts with PLCE1. Interacts with TBC1D10C and RASSF5. Interacts with PDE6D. Interacts with IKZF3. Found in a complex with at least BRAF, HRAS, MAP2K1, MAPK3 and RGS14. Interacts (active GTP-bound form) with RGS14 (via RBD 1 domain). Interacts with GNB2L1. Interacts with RAPGEF2 By similarity. Interacts with RGL3. Interacts with HSPD1. Interacts with PIK3CG; the interaction is required for membrane recruitment and beta-gamma G protein dimer-dependent activation of the PI3K gamma complex PIK3CG:PIK3R6.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Rassf5Q5EBH12EBI-400273,EBI-960530

Protein-protein interaction databases

BioGridi200416. 15 interactions.
DIPiDIP-29361N.
IntActiQ61411. 9 interactions.
MINTiMINT-1215825.

Structurei

3D structure databases

ProteinModelPortaliQ61411.
SMRiQ61411. Positions 1-166.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni166 – 18520Hypervariable regionAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi32 – 409Effector region

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG1100.
GeneTreeiENSGT00750000117221.
HOGENOMiHOG000233973.
HOVERGENiHBG009351.
KOiK02833.
OMAiEKSGCCV.
OrthoDBiEOG7QVM41.
TreeFamiTF312796.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR020849. Small_GTPase_Ras.
[Graphical view]
PANTHERiPTHR24070. PTHR24070. 1 hit.
PfamiPF00071. Ras. 1 hit.
[Graphical view]
PRINTSiPR00449. RASTRNSFRMNG.
SMARTiSM00173. RAS. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51421. RAS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q61411-1) [UniParc]FASTAAdd to Basket

Also known as: p21, H-Ras4A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MTEYKLVVVG AGGVGKSALT IQLIQNHFVD EYDPTIEDSY RKQVVIDGET    50
CLLDILDTAG QEEYSAMRDQ YMRTGEGFLC VFAINNTKSF EDIHQYREQI 100
KRVKDSDDVP MVLVGNKCDL AARTVESRQA QDLARSYGIP YIETSAKTRQ 150
GVEDAFYTLV REIRQHKLRK LNPPDESGPG CMSCKCVLS 189
Length:189
Mass (Da):21,298
Last modified:July 27, 2011 - v2
Checksum:iEE6DC2D933E2856A
GO
Isoform 2 (identifier: Q61411-2) [UniParc]FASTAAdd to Basket

Also known as: p19, H-RasIDX

The sequence of this isoform differs from the canonical sequence as follows:
     152-189: VEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS → SRSGSSSGTLWDPPSPGTHVTQRPSSWRGGCLLYTSP

Show »
Length:188
Mass (Da):20,880
Checksum:iBD42AE50A77341FF
GO

Sequence cautioni

The sequence AAH61885.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei152 – 18938VEDAF…KCVLS → SRSGSSSGTLWDPPSPGTHV TQRPSSWRGGCLLYTSP in isoform 2. VSP_041598Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti55 – 551I → Y in CAA90306. 1 Publication
Isoform 2 (identifier: Q61411-2)
Sequence conflicti163 – 1631D → G in CAD24593. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z50013 Genomic DNA. Translation: CAA90306.1.
AY373386 mRNA. Translation: AAQ81319.1.
AC108908 Genomic DNA. No translation available.
CH466531 Genomic DNA. Translation: EDL18008.1.
CH466531 Genomic DNA. Translation: EDL18009.1.
BC061885 mRNA. Translation: AAH61885.1. Different initiation.
S74119 Genomic DNA. Translation: AAP21090.1.
AJ437023 mRNA. Translation: CAD24593.1.
CCDSiCCDS22003.1. [Q61411-1]
CCDS52439.1. [Q61411-2]
PIRiS57718.
RefSeqiNP_001123915.1. NM_001130443.1. [Q61411-1]
NP_001123916.1. NM_001130444.1. [Q61411-2]
NP_032310.2. NM_008284.2. [Q61411-1]
UniGeneiMm.334313.

Genome annotation databases

EnsembliENSMUST00000026572; ENSMUSP00000026572; ENSMUSG00000025499. [Q61411-1]
ENSMUST00000097957; ENSMUSP00000095570; ENSMUSG00000025499. [Q61411-1]
ENSMUST00000168550; ENSMUSP00000132110; ENSMUSG00000025499. [Q61411-2]
GeneIDi15461.
KEGGimmu:15461.
UCSCiuc009kju.2. mouse. [Q61411-1]
uc009kjv.2. mouse. [Q61411-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z50013 Genomic DNA. Translation: CAA90306.1 .
AY373386 mRNA. Translation: AAQ81319.1 .
AC108908 Genomic DNA. No translation available.
CH466531 Genomic DNA. Translation: EDL18008.1 .
CH466531 Genomic DNA. Translation: EDL18009.1 .
BC061885 mRNA. Translation: AAH61885.1 . Different initiation.
S74119 Genomic DNA. Translation: AAP21090.1 .
AJ437023 mRNA. Translation: CAD24593.1 .
CCDSi CCDS22003.1. [Q61411-1 ]
CCDS52439.1. [Q61411-2 ]
PIRi S57718.
RefSeqi NP_001123915.1. NM_001130443.1. [Q61411-1 ]
NP_001123916.1. NM_001130444.1. [Q61411-2 ]
NP_032310.2. NM_008284.2. [Q61411-1 ]
UniGenei Mm.334313.

3D structure databases

ProteinModelPortali Q61411.
SMRi Q61411. Positions 1-166.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 200416. 15 interactions.
DIPi DIP-29361N.
IntActi Q61411. 9 interactions.
MINTi MINT-1215825.

Chemistry

BindingDBi Q61411.

PTM databases

PhosphoSitei Q61411.

Proteomic databases

MaxQBi Q61411.
PaxDbi Q61411.
PRIDEi Q61411.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000026572 ; ENSMUSP00000026572 ; ENSMUSG00000025499 . [Q61411-1 ]
ENSMUST00000097957 ; ENSMUSP00000095570 ; ENSMUSG00000025499 . [Q61411-1 ]
ENSMUST00000168550 ; ENSMUSP00000132110 ; ENSMUSG00000025499 . [Q61411-2 ]
GeneIDi 15461.
KEGGi mmu:15461.
UCSCi uc009kju.2. mouse. [Q61411-1 ]
uc009kjv.2. mouse. [Q61411-2 ]

Organism-specific databases

CTDi 3265.
MGIi MGI:96224. Hras.

Phylogenomic databases

eggNOGi COG1100.
GeneTreei ENSGT00750000117221.
HOGENOMi HOG000233973.
HOVERGENi HBG009351.
KOi K02833.
OMAi EKSGCCV.
OrthoDBi EOG7QVM41.
TreeFami TF312796.

Enzyme and pathway databases

Reactomei REACT_188185. DAP12 signaling.
REACT_188528. GRB2 events in ERBB2 signaling.
REACT_188530. FCERI mediated MAPK activation.
REACT_188574. SHC1 events in ERBB2 signaling.
REACT_188578. Signaling by SCF-KIT.
REACT_188580. SHC1 events in ERBB4 signaling.
REACT_196455. Signaling by FGFR mutants.
REACT_198244. Ras activation uopn Ca2+ infux through NMDA receptor.
REACT_198350. EGFR Transactivation by Gastrin.
REACT_199122. Activation of RAS in B cells.
REACT_199123. Signaling by constitutively active EGFR.
REACT_207601. p38MAPK events.
REACT_210793. Interleukin receptor SHC signaling.
REACT_211860. Tie2 Signaling.
REACT_94437. SHC-mediated cascade.

Miscellaneous databases

ChiTaRSi HRAS. mouse.
NextBioi 288278.
PROi Q61411.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q61411.
Bgeei Q61411.
CleanExi MM_HRAS1.
Genevestigatori Q61411.

Family and domain databases

Gene3Di 3.40.50.300. 1 hit.
InterProi IPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR020849. Small_GTPase_Ras.
[Graphical view ]
PANTHERi PTHR24070. PTHR24070. 1 hit.
Pfami PF00071. Ras. 1 hit.
[Graphical view ]
PRINTSi PR00449. RASTRNSFRMNG.
SMARTi SM00173. RAS. 1 hit.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 1 hit.
TIGRFAMsi TIGR00231. small_GTP. 1 hit.
PROSITEi PS51421. RAS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Nucleotide sequence of c-H-ras-1 gene from B6C3F1 mice."
    Przybojewska B., Plucienniczak G.
    Acta Biochim. Pol. 43:575-578(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    Strain: C57BL/6 X C3H.
    Tissue: Liver.
  2. Lin L., Fu D.
    Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: BALB/c.
    Tissue: Keratinocyte.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Olfactory epithelium.
  6. "Spontaneous mutation at codon 61 of the Ha-ras gene in the nascent liver of B6C3F1, C3H/He and C57BL/6 mice."
    Moulds B.A., Goodman J.I.
    Mutat. Res. 311:1-7(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 59-75, MUTAGENESIS OF GLN-61.
  7. Lubec G., Kang S.U.
    Submitted (APR-2007) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 136-147, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: C57BL/6.
    Tissue: Brain.
  8. "Alternative splicing of the human proto-oncogene c-H-ras renders a new Ras family protein that trafficks to cytoplasm and nucleus."
    Guil S., de La Iglesia N., Fernandez-Larrea J., Cifuentes D., Ferrer J.C., Guinovart J.J., Bach-Elias M.
    Cancer Res. 63:5178-5187(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 151-189 (ISOFORM 2), ALTERNATIVE SPLICING.
    Strain: NIH/3T3.
  9. "An interaction between p21ras and heat shock protein hsp60, a chaperonin."
    Ikawa S., Weinberg R.A.
    Proc. Natl. Acad. Sci. U.S.A. 89:2012-2016(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH HSPD1.
  10. "A novel RalGEF-like protein, RGL3, as a candidate effector for rit and Ras."
    Shao H., Andres D.A.
    J. Biol. Chem. 275:26914-26924(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH RGL3.
  11. Cited for: INTERACTION WITH PIK3CG.

Entry informationi

Entry nameiRASH_MOUSE
AccessioniPrimary (citable) accession number: Q61411
Secondary accession number(s): F7BIB2
, Q6P716, Q80WD2, Q811B9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: July 27, 2011
Last modified: September 3, 2014
This is version 132 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi