Q61411 (RASH_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 117.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: GTPase HRas Alternative name(s): H-Ras-1 Transforming protein p21 c-H-ras p21ras Cleaved into the following chain: | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 189 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. |
| Enzyme regulation | Alternate between an inactive form bound to GDP and an active form bound to GTP. Activated by a guanine nucleotide-exchange factor (GEF) and inactivated by a GTPase-activating protein (GAP). |
| Subunit structure | Forms a signaling complex with RASGRP1 and DGKZ. In its GTP-bound form interacts with PLCE1. Interacts with TBC1D10C and RASSF5. Interacts with PDE6D. Interacts with IKZF3. Found in a complex with at least BRAF, HRAS1, MAP2K1, MAPK3 and RGS14. Interacts (active GTP-bound form) with RGS14 (via RBD 1 domain). Interacts with GNB2L1 By similarity. Interacts with RGL3. Interacts with HSPD1. Interacts with PIK3CG; the interaction is required for membrane recruitment and beta-gamma G protein dimer-dependent activation of the PI3K gamma complex PIK3CG:PIK3R6. Ref.7 Ref.8 Ref.9 |
| Subcellular location | Cell membrane By similarity. Cell membrane; Lipid-anchor; Cytoplasmic side By similarity. Golgi apparatus By similarity. Golgi apparatus membrane; Lipid-anchor By similarity. Note: Shuttles between the plasma membrane and the Golgi apparatus. The active GTP-bound form is localized most strongly to membranes than the inactive GDP-bound form By similarity. |
| Post-translational modification | Palmitoylated by the ZDHHC9-GOLGA7 complex. A continuous cycle of de- and re-palmitoylation regulates rapid exchange between plasma membrane and Golgi By similarity. S-nitrosylated; critical for redox regulation. Important for stimulating guanine nucleotide exchange. No structural perturbation on nitrosylation. The covalent modification of cysteine by 15-deoxy-Delta12,14-prostaglandin-J2 is autocatalytic and reversible. It may occur as an alternative to other cysteine modifications, such as S-nitrosylation and S-palmitoylation By similarity. Acetylation at Lys-104 prevents interaction with guanine nucleotide exchange factors (GEFs) By similarity. |
| Sequence similarities | Belongs to the small GTPase superfamily. Ras family. |
| Sequence caution | The sequence AAH61885.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Rassf5 | Q5EBH1 | 2 | EBI-400273,EBI-960530 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q61411-1) Also known as: p21; H-Ras4A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q61411-2) Also known as: p19; H-RasIDX; The sequence of this isoform differs from the canonical sequence as follows: 152-189: VEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS → SRSGSSSGTLWDPPSPGTHVTQRPSSWRGGCLLYTSP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 186 | 186 | GTPase HRas | PRO_0000042998 | |||||
| Initiator methionine | 1 | 1 | Removed; alternate By similarity | ||||||
| Chain | 2 – 186 | 185 | GTPase HRas, N-terminally processed | PRO_0000326478 | |||||
| Propeptide | 187 – 189 | 3 | Removed in mature form By similarity | PRO_0000042999 | |||||
Regions | |||||||||
| Nucleotide binding | 10 – 17 | 8 | GTP By similarity | ||||||
| Nucleotide binding | 57 – 61 | 5 | GTP By similarity | ||||||
| Nucleotide binding | 116 – 119 | 4 | GTP By similarity | ||||||
| Region | 166 – 185 | 20 | Hypervariable region | ||||||
| Motif | 32 – 40 | 9 | Effector region | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1 | 1 | N-acetylmethionine; alternate By similarity | ||||||
| Modified residue | 2 | 1 | N-acetylthreonine; in GTPase HRas, N-terminally processed By similarity | ||||||
| Modified residue | 118 | 1 | S-nitrosocysteine By similarity | ||||||
| Modified residue | 186 | 1 | Cysteine methyl ester By similarity | ||||||
| Lipidation | 181 | 1 | S-palmitoyl cysteine By similarity | ||||||
| Lipidation | 184 | 1 | S-(15-deoxy-Delta12,14-prostaglandin J2-9-yl)cysteine; alternate By similarity | ||||||
| Lipidation | 184 | 1 | S-palmitoyl cysteine; alternate By similarity | ||||||
| Lipidation | 186 | 1 | S-farnesyl cysteine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 152 – 189 | 38 | VEDAF…KCVLS → SRSGSSSGTLWDPPSPGTHV TQRPSSWRGGCLLYTSP in isoform 2. | VSP_041598 | |||||
Experimental info | |||||||||
| Mutagenesis | 61 | 1 | Q → R: Found in chemically induced liver tumors. Ref.4 | ||||||
| Sequence conflict | 55 | 1 | I → Y in CAA90306. Ref.1 | ||||||
| Isoform 2: | |||||||||
| Sequence conflict | 163 | 1 | D → G in CAD24593. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Nucleotide sequence of c-H-ras-1 gene from B6C3F1 mice." Przybojewska B., Plucienniczak G. Acta Biochim. Pol. 43:575-578(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Strain: C57BL/6 X C3H. Tissue: Liver. |
| [2] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Olfactory epithelium. |
| [4] | "Spontaneous mutation at codon 61 of the Ha-ras gene in the nascent liver of B6C3F1, C3H/He and C57BL/6 mice." Moulds B.A., Goodman J.I. Mutat. Res. 311:1-7(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 59-75, MUTAGENESIS OF GLN-61. |
| [5] | Lubec G., Kang S.U. Submitted (APR-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 136-147, MASS SPECTROMETRY. Strain: C57BL/6. Tissue: Brain. |
| [6] | "Alternative splicing of the human proto-oncogene c-H-ras renders a new Ras family protein that trafficks to cytoplasm and nucleus." Guil S., de La Iglesia N., Fernandez-Larrea J., Cifuentes D., Ferrer J.C., Guinovart J.J., Bach-Elias M. Cancer Res. 63:5178-5187(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 151-189 (ISOFORM 2), ALTERNATIVE SPLICING. Strain: NIH/3T3. |
| [7] | "An interaction between p21ras and heat shock protein hsp60, a chaperonin." Ikawa S., Weinberg R.A. Proc. Natl. Acad. Sci. U.S.A. 89:2012-2016(1992) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HSPD1. |
| [8] | "A novel RalGEF-like protein, RGL3, as a candidate effector for rit and Ras." Shao H., Andres D.A. J. Biol. Chem. 275:26914-26924(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RGL3. |
| [9] | "Ras is an indispensable coregulator of the class IB phosphoinositide 3-kinase p87/p110gamma." Kurig B., Shymanets A., Bohnacker T., Prajwal X., Brock C., Ahmadian M.R., Schaefer M., Gohla A., Harteneck C., Wymann M.P., Jeanclos E., Nurnberg B. Proc. Natl. Acad. Sci. U.S.A. 106:20312-20317(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PIK3CG. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Z50013 Genomic DNA. Translation: CAA90306.1. AC108908 Genomic DNA. No translation available. BC061885 mRNA. Translation: AAH61885.1. Different initiation. S74119 Genomic DNA. Translation: AAP21090.1. AJ437023 mRNA. Translation: CAD24593.1. |
| IPI | IPI00605942. IPI01023179. |
| PIR | S57718. |
| RefSeq | NP_001123915.1. NM_001130443.1. NP_001123916.1. NM_001130444.1. NP_032310.2. NM_008284.2. |
| UniGene | Mm.334313. |
3D structure databases | |
| ProteinModelPortal | Q61411. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-29361N. |
| IntAct | Q61411. 7 interactions. |
| MINT | MINT-1215825. |
PTM databases | |
| PhosphoSite | Q61411. |
Proteomic databases | |
| PaxDb | Q61411. |
| PRIDE | Q61411. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000026572; ENSMUSP00000026572; ENSMUSG00000025499. ENSMUST00000097957; ENSMUSP00000095570; ENSMUSG00000025499. ENSMUST00000168550; ENSMUSP00000132110; ENSMUSG00000025499. |
| GeneID | 15461. |
| KEGG | mmu:15461. |
Organism-specific databases | |
| CTD | 15461. |
| MGI | MGI:96224. Hras1. |
Phylogenomic databases | |
| eggNOG | COG1100. |
| GeneTree | ENSGT00690000101785. |
| HOGENOM | HOG000233973. |
| HOVERGEN | HBG009351. |
| KO | K02833. |
| OMA | IDDETCL. |
| OrthoDB | EOG4BRWMX. |
Gene expression databases | |
| ArrayExpress | Q61411. |
| Bgee | Q61411. |
| CleanEx | MM_HRAS1. |
| Genevestigator | Q61411. |
| GermOnline | ENSMUSG00000025499. Mus musculus. |
Family and domain databases | |
| InterPro | IPR005225. Small_GTP-bd_dom. IPR001806. Small_GTPase. IPR020849. Small_GTPase_Ras. [Graphical view] |
| PANTHER | PTHR24070. PTHR24070. 1 hit. |
| Pfam | PF00071. Ras. 1 hit. [Graphical view] |
| PRINTS | PR00449. RASTRNSFRMNG. |
| SMART | SM00173. RAS. 1 hit. [Graphical view] |
| TIGRFAMs | TIGR00231. small_GTP. 1 hit. |
| PROSITE | PS51421. RAS. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q61411. |
| ChiTaRS | HRAS. mouse. |
| NextBio | 288278. |
| SOURCE | Search... |
Entry information
| Entry name | RASH_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q61411 Secondary accession number(s): Q6P716, Q80WD2, Q811B9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
