Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q61411 (RASH_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 128. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
GTPase HRas
Alternative name(s):
H-Ras-1
Transforming protein p21
c-H-ras
p21ras

Cleaved into the following chain:

  1. GTPase HRas, N-terminally processed
Gene names
Name:Hras
Synonyms:Hras1
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length189 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.

Enzyme regulation

Alternates between an inactive form bound to GDP and an active form bound to GTP. Activated by a guanine nucleotide-exchange factor (GEF) and inactivated by a GTPase-activating protein (GAP).

Subunit structure

Forms a signaling complex with RASGRP1 and DGKZ. In its GTP-bound form interacts with PLCE1. Interacts with TBC1D10C and RASSF5. Interacts with PDE6D. Interacts with IKZF3. Found in a complex with at least BRAF, HRAS, MAP2K1, MAPK3 and RGS14. Interacts (active GTP-bound form) with RGS14 (via RBD 1 domain). Interacts with GNB2L1. Interacts with RAPGEF2 By similarity. Interacts with RGL3. Interacts with HSPD1. Interacts with PIK3CG; the interaction is required for membrane recruitment and beta-gamma G protein dimer-dependent activation of the PI3K gamma complex PIK3CG:PIK3R6. Ref.9 Ref.10 Ref.11

Subcellular location

Cell membrane By similarity. Cell membrane; Lipid-anchor; Cytoplasmic side By similarity. Golgi apparatus By similarity. Golgi apparatus membrane; Lipid-anchor By similarity. Note: Shuttles between the plasma membrane and the Golgi apparatus. The active GTP-bound form is localized most strongly to membranes than the inactive GDP-bound form By similarity.

Post-translational modification

Palmitoylated by the ZDHHC9-GOLGA7 complex. A continuous cycle of de- and re-palmitoylation regulates rapid exchange between plasma membrane and Golgi By similarity.

S-nitrosylated; critical for redox regulation. Important for stimulating guanine nucleotide exchange. No structural perturbation on nitrosylation.

The covalent modification of cysteine by 15-deoxy-Delta12,14-prostaglandin-J2 is autocatalytic and reversible. It may occur as an alternative to other cysteine modifications, such as S-nitrosylation and S-palmitoylation By similarity.

Acetylation at Lys-104 prevents interaction with guanine nucleotide exchange factors (GEFs) By similarity.

Sequence similarities

Belongs to the small GTPase superfamily. Ras family.

Sequence caution

The sequence AAH61885.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Ontologies

Keywords
   Cellular componentCell membrane
Golgi apparatus
Membrane
   Coding sequence diversityAlternative splicing
   DiseaseProto-oncogene
   LigandGTP-binding
Nucleotide-binding
   PTMAcetylation
Lipoprotein
Methylation
Palmitate
Prenylation
S-nitrosylation
   Technical termComplete proteome
Direct protein sequencing
Reference proteome
Gene Ontology (GO)
   Biological_processGTP catabolic process

Inferred from electronic annotation. Source: InterPro

Ras protein signal transduction

Traceable author statement PubMed 10871846. Source: MGI

cell aging

Inferred from direct assay PubMed 12878730PubMed 15572682. Source: MGI

cell cycle arrest

Inferred from electronic annotation. Source: Ensembl

cell proliferation

Inferred from physical interaction PubMed 14712229. Source: MGI

cellular senescence

Inferred from electronic annotation. Source: Ensembl

endocytosis

Inferred from direct assay PubMed 12446704. Source: MGI

intrinsic apoptotic signaling pathway

Inferred from mutant phenotype PubMed 16954213. Source: MGI

mitotic cell cycle checkpoint

Inferred from electronic annotation. Source: Ensembl

negative regulation of Rho GTPase activity

Inferred from electronic annotation. Source: Ensembl

negative regulation of cell proliferation

Inferred from electronic annotation. Source: Ensembl

negative regulation of gene expression

Inferred from electronic annotation. Source: Ensembl

negative regulation of neuron apoptotic process

Inferred from direct assay PubMed 10845775. Source: MGI

positive regulation of DNA replication

Inferred from electronic annotation. Source: Ensembl

positive regulation of ERK1 and ERK2 cascade

Inferred from electronic annotation. Source: Ensembl

positive regulation of JNK cascade

Inferred from electronic annotation. Source: Ensembl

positive regulation of MAP kinase activity

Inferred from electronic annotation. Source: Ensembl

positive regulation of Rac GTPase activity

Inferred from electronic annotation. Source: Ensembl

positive regulation of Ras protein signal transduction

Inferred from sequence orthology PubMed 19029245. Source: MGI

positive regulation of actin cytoskeleton reorganization

Inferred from electronic annotation. Source: Ensembl

positive regulation of cell migration

Inferred from electronic annotation. Source: Ensembl

positive regulation of cell proliferation

Inferred from direct assay PubMed 16478791. Source: MGI

positive regulation of epithelial cell proliferation

Inferred from electronic annotation. Source: Ensembl

positive regulation of gene expression

Inferred from direct assay PubMed 21357543. Source: MGI

positive regulation of miRNA metabolic process

Inferred from electronic annotation. Source: Ensembl

positive regulation of ruffle assembly

Inferred from electronic annotation. Source: Ensembl

positive regulation of transcription from RNA polymerase II promoter

Inferred from electronic annotation. Source: Ensembl

positive regulation of wound healing

Inferred from electronic annotation. Source: Ensembl

protein heterooligomerization

Inferred from electronic annotation. Source: Ensembl

regulation of long-term neuronal synaptic plasticity

Inferred from mutant phenotype PubMed 12427827. Source: MGI

small GTPase mediated signal transduction

Inferred from direct assay PubMed 14712229. Source: MGI

social behavior

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentGolgi apparatus

Inferred from sequence or structural similarity. Source: UniProtKB

Golgi membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

plasma membrane

Inferred from sequence or structural similarity. Source: UniProtKB

   Molecular_functionGTP binding

Inferred from direct assay PubMed 18604197. Source: MGI

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

Rassf5Q5EBH12EBI-400273,EBI-960530

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q61411-1)

Also known as: p21; H-Ras4A;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q61411-2)

Also known as: p19; H-RasIDX;

The sequence of this isoform differs from the canonical sequence as follows:
     152-189: VEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS → SRSGSSSGTLWDPPSPGTHVTQRPSSWRGGCLLYTSP

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 186186GTPase HRas
PRO_0000042998
Initiator methionine11Removed; alternate By similarity
Chain2 – 186185GTPase HRas, N-terminally processed
PRO_0000326478
Propeptide187 – 1893Removed in mature form By similarity
PRO_0000042999

Regions

Nucleotide binding10 – 178GTP By similarity
Nucleotide binding57 – 615GTP By similarity
Nucleotide binding116 – 1194GTP By similarity
Region166 – 18520Hypervariable region
Motif32 – 409Effector region

Amino acid modifications

Modified residue11N-acetylmethionine By similarity
Modified residue21N-acetylthreonine; in GTPase HRas, N-terminally processed By similarity
Modified residue1181S-nitrosocysteine By similarity
Modified residue1861Cysteine methyl ester By similarity
Lipidation1811S-palmitoyl cysteine By similarity
Lipidation1841S-(15-deoxy-Delta12,14-prostaglandin J2-9-yl)cysteine; alternate By similarity
Lipidation1841S-palmitoyl cysteine; alternate By similarity
Lipidation1861S-farnesyl cysteine By similarity

Natural variations

Alternative sequence152 – 18938VEDAF…KCVLS → SRSGSSSGTLWDPPSPGTHV TQRPSSWRGGCLLYTSP in isoform 2.
VSP_041598

Experimental info

Mutagenesis611Q → R: Found in chemically induced liver tumors. Ref.6
Sequence conflict551I → Y in CAA90306. Ref.1
Isoform 2:
Sequence conflict1631D → G in CAD24593. Ref.8

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (p21) (H-Ras4A) [UniParc].

Last modified July 27, 2011. Version 2.
Checksum: EE6DC2D933E2856A

FASTA18921,298
        10         20         30         40         50         60 
MTEYKLVVVG AGGVGKSALT IQLIQNHFVD EYDPTIEDSY RKQVVIDGET CLLDILDTAG 

        70         80         90        100        110        120 
QEEYSAMRDQ YMRTGEGFLC VFAINNTKSF EDIHQYREQI KRVKDSDDVP MVLVGNKCDL 

       130        140        150        160        170        180 
AARTVESRQA QDLARSYGIP YIETSAKTRQ GVEDAFYTLV REIRQHKLRK LNPPDESGPG 


CMSCKCVLS 

« Hide

Isoform 2 (p19) (H-RasIDX) [UniParc].

Checksum: BD42AE50A77341FF
Show »

FASTA18820,880

References

« Hide 'large scale' references
[1]"Nucleotide sequence of c-H-ras-1 gene from B6C3F1 mice."
Przybojewska B., Plucienniczak G.
Acta Biochim. Pol. 43:575-578(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Strain: C57BL/6 X C3H.
Tissue: Liver.
[2]Lin L., Fu D.
Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: BALB/c.
Tissue: Keratinocyte.
[3]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Olfactory epithelium.
[6]"Spontaneous mutation at codon 61 of the Ha-ras gene in the nascent liver of B6C3F1, C3H/He and C57BL/6 mice."
Moulds B.A., Goodman J.I.
Mutat. Res. 311:1-7(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 59-75, MUTAGENESIS OF GLN-61.
[7]Lubec G., Kang S.U.
Submitted (APR-2007) to UniProtKB
Cited for: PROTEIN SEQUENCE OF 136-147, IDENTIFICATION BY MASS SPECTROMETRY.
Strain: C57BL/6.
Tissue: Brain.
[8]"Alternative splicing of the human proto-oncogene c-H-ras renders a new Ras family protein that trafficks to cytoplasm and nucleus."
Guil S., de La Iglesia N., Fernandez-Larrea J., Cifuentes D., Ferrer J.C., Guinovart J.J., Bach-Elias M.
Cancer Res. 63:5178-5187(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 151-189 (ISOFORM 2), ALTERNATIVE SPLICING.
Strain: NIH/3T3.
[9]"An interaction between p21ras and heat shock protein hsp60, a chaperonin."
Ikawa S., Weinberg R.A.
Proc. Natl. Acad. Sci. U.S.A. 89:2012-2016(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH HSPD1.
[10]"A novel RalGEF-like protein, RGL3, as a candidate effector for rit and Ras."
Shao H., Andres D.A.
J. Biol. Chem. 275:26914-26924(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH RGL3.
[11]"Ras is an indispensable coregulator of the class IB phosphoinositide 3-kinase p87/p110gamma."
Kurig B., Shymanets A., Bohnacker T., Prajwal X., Brock C., Ahmadian M.R., Schaefer M., Gohla A., Harteneck C., Wymann M.P., Jeanclos E., Nurnberg B.
Proc. Natl. Acad. Sci. U.S.A. 106:20312-20317(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH PIK3CG.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
Z50013 Genomic DNA. Translation: CAA90306.1.
AY373386 mRNA. Translation: AAQ81319.1.
AC108908 Genomic DNA. No translation available.
CH466531 Genomic DNA. Translation: EDL18008.1.
CH466531 Genomic DNA. Translation: EDL18009.1.
BC061885 mRNA. Translation: AAH61885.1. Different initiation.
S74119 Genomic DNA. Translation: AAP21090.1.
AJ437023 mRNA. Translation: CAD24593.1.
PIRS57718.
RefSeqNP_001123915.1. NM_001130443.1.
NP_001123916.1. NM_001130444.1.
NP_032310.2. NM_008284.2.
UniGeneMm.334313.

3D structure databases

ProteinModelPortalQ61411.
SMRQ61411. Positions 1-166.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid200416. 14 interactions.
DIPDIP-29361N.
IntActQ61411. 9 interactions.
MINTMINT-1215825.

Chemistry

BindingDBQ61411.

PTM databases

PhosphoSiteQ61411.

Proteomic databases

PaxDbQ61411.
PRIDEQ61411.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000026572; ENSMUSP00000026572; ENSMUSG00000025499. [Q61411-1]
ENSMUST00000097957; ENSMUSP00000095570; ENSMUSG00000025499. [Q61411-1]
ENSMUST00000168550; ENSMUSP00000132110; ENSMUSG00000025499. [Q61411-2]
GeneID15461.
KEGGmmu:15461.
UCSCuc009kju.2. mouse. [Q61411-1]
uc009kjv.2. mouse. [Q61411-2]

Organism-specific databases

CTD3265.
MGIMGI:96224. Hras.

Phylogenomic databases

eggNOGCOG1100.
GeneTreeENSGT00750000117221.
HOGENOMHOG000233973.
HOVERGENHBG009351.
KOK02833.
OMARSSYDEI.
OrthoDBEOG7QVM41.
TreeFamTF312796.

Gene expression databases

ArrayExpressQ61411.
BgeeQ61411.
CleanExMM_HRAS1.
GenevestigatorQ61411.

Family and domain databases

Gene3D3.40.50.300. 1 hit.
InterProIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR020849. Small_GTPase_Ras.
[Graphical view]
PANTHERPTHR24070. PTHR24070. 1 hit.
PfamPF00071. Ras. 1 hit.
[Graphical view]
PRINTSPR00449. RASTRNSFRMNG.
SMARTSM00173. RAS. 1 hit.
[Graphical view]
SUPFAMSSF52540. SSF52540. 1 hit.
TIGRFAMsTIGR00231. small_GTP. 1 hit.
PROSITEPS51421. RAS. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSHRAS. mouse.
NextBio288278.
PROQ61411.
SOURCESearch...

Entry information

Entry nameRASH_MOUSE
AccessionPrimary (citable) accession number: Q61411
Secondary accession number(s): F7BIB2 expand/collapse secondary AC list , Q6P716, Q80WD2, Q811B9
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: July 27, 2011
Last modified: April 16, 2014
This is version 128 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot