Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Eukaryotic translation initiation factor 2D

Gene

Eif2d

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Translation initiation factor that is able to deliver tRNA to the P-site of the eukaryotic ribosome in a GTP-independent manner. The binding of Met-tRNA(I) occurs after the AUG codon finds its position in the P-site of 40S ribosomes, the situation that takes place during initiation complex formation on some specific RNAs. Its activity in tRNA binding with 40S subunits does not require the presence of the aminoacyl moiety. Possesses the unique ability to deliver non-Met (elongator) tRNAs into the P-site of the 40S subunit. In addition to its role in initiation, can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Initiation factor

Keywords - Biological processi

Protein biosynthesis

Names & Taxonomyi

Protein namesi
Recommended name:
Eukaryotic translation initiation factor 2D
Short name:
eIF2D
Alternative name(s):
Ligatin
Gene namesi
Name:Eif2d
Synonyms:Lgtn
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:109342. Eif2d.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 570570Eukaryotic translation initiation factor 2DPRO_0000130612Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineBy similarity
Modified residuei238 – 2381PhosphoserineCombined sources
Modified residuei241 – 2411PhosphoserineCombined sources
Modified residuei348 – 3481PhosphoserineBy similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ61211.
MaxQBiQ61211.
PaxDbiQ61211.
PRIDEiQ61211.

PTM databases

iPTMnetiQ61211.
PhosphoSiteiQ61211.

Miscellaneous databases

PMAP-CutDBQ61211.

Expressioni

Gene expression databases

BgeeiENSMUSG00000026427.
CleanExiMM_LGTN.
ExpressionAtlasiQ61211. baseline and differential.
GenevisibleiQ61211. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000063894.

Structurei

3D structure databases

ProteinModelPortaliQ61211.
SMRiQ61211. Positions 1-177.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini93 – 17381PUAPROSITE-ProRule annotationAdd
BLAST
Domaini478 – 54871SUI1PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the eIF2D family.Curated
Contains 1 PUA domain.PROSITE-ProRule annotation
Contains 1 SUI1 domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG2522. Eukaryota.
ENOG410XSAV. LUCA.
GeneTreeiENSGT00550000074865.
HOVERGENiHBG006268.
InParanoidiQ61211.
KOiK15027.
OrthoDBiEOG091G0DTH.
PhylomeDBiQ61211.
TreeFamiTF105830.

Family and domain databases

Gene3Di2.30.130.10. 1 hit.
InterProiIPR002478. PUA.
IPR015947. PUA-like_domain.
IPR001950. SUI1.
IPR003121. SWIB_MDM2_domain.
[Graphical view]
PfamiPF01253. SUI1. 1 hit.
[Graphical view]
SMARTiSM00359. PUA. 1 hit.
[Graphical view]
SUPFAMiSSF47592. SSF47592. 1 hit.
SSF55159. SSF55159. 1 hit.
SSF88697. SSF88697. 1 hit.
PROSITEiPS50890. PUA. 1 hit.
PS50296. SUI1. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q61211-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFAKAFRVKS NTAIKGSDRR KLRADVTAAF PALGTDQISE LIPGKEELNV
60 70 80 90 100
VKLYVHKGDS VTVYTSGGNP ILFELEKNLY PTVYTLWAYP DILPTFITWP
110 120 130 140 150
LVLEKLVGGA DLMLPGVVVP PTGLPQVQQG DLCAIALVGN RAPVAIGVAA
160 170 180 190 200
MSTAQMLASG LKGKGVSVLH TYQDHLWRSG DKSSPPAIAP LDPTDSCEEK
210 220 230 240 250
VHLGLQGNLK SLTLDGEEEN GQVPLREASE DTSSRAPSQD SLDGKPLQEQ
260 270 280 290 300
MDDLLLRCFL HALKSRVKKA DLPLLTSTLL GSHMFSCCPE GQQLDIKKSS
310 320 330 340 350
YKKLSKFLQH MQQEQIVQVK ELSKGVESIV AVDWRHPRIT SFVIPEPSLT
360 370 380 390 400
SQTVQEVSRE QPYLPPDIKS LYCVPANMTQ LFLESGHKKG STLEGSEVRK
410 420 430 440 450
IITDYAKRNR LVDADNRNLV KLDPILCDCI LEKNEQHLVT KLPWDCLLTR
460 470 480 490 500
CLKNMQPAYQ VTFPGQEPIL KKGKLCPIDI TLALKTYNKK VTVVRNLETY
510 520 530 540 550
GLDPCSVAAI LQQRCQASTI VSPAPGAKDS LQVQVQGNQI HHLGQLLLEE
560 570
YRLPGKYIQG LEKAPKPGKK
Length:570
Mass (Da):62,830
Last modified:November 22, 2005 - v3
Checksum:i68DAA2768A595AC8
GO
Isoform 2 (identifier: Q61211-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     551-570: YRLPGKYIQGLEKAPKPGKK → NTGTLHLPAQYPHPHVQNKPEIPHLSCCGLPASHDSI

Note: No experimental confirmation available.
Show »
Length:587
Mass (Da):64,569
Checksum:iB7728E545EA0E496
GO

Sequence cautioni

The sequence AAC53056 differs from that shown. Reason: Frameshift at position 4. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti176 – 1794LWRS → HASA in AAH24501 (PubMed:15489334).Curated
Sequence conflicti177 – 1771W → V in AAC53056 (PubMed:9070942).Curated
Sequence conflicti249 – 2491E → K in BAE36281 (PubMed:16141072).Curated
Sequence conflicti268 – 2681K → E in BAE41662 (PubMed:16141072).Curated
Sequence conflicti289 – 2891P → R in BAE40091 (PubMed:16141072).Curated
Sequence conflicti341 – 3411S → P in BAC28591 (PubMed:16141072).Curated
Sequence conflicti549 – 5491E → G in BAC29323 (PubMed:16141072).Curated
Sequence conflicti549 – 5491E → G in BAC38598 (PubMed:16141072).Curated
Sequence conflicti549 – 5491E → G (PubMed:9070942).Curated
Sequence conflicti550 – 5523EYR → IMW in BAC28591 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei551 – 57020YRLPG…KPGKK → NTGTLHLPAQYPHPHVQNKP EIPHLSCCGLPASHDSI in isoform 2. 1 PublicationVSP_016233Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK034115 mRNA. Translation: BAC28591.1.
AK036154 mRNA. Translation: BAC29323.1.
AK046539 mRNA. Translation: BAC32777.1.
AK082748 mRNA. Translation: BAC38598.1.
AK083638 mRNA. Translation: BAC38976.1.
AK139052 mRNA. Translation: BAE23874.1.
AK161269 mRNA. Translation: BAE36281.1.
AK167980 mRNA. Translation: BAE39972.1.
AK168120 mRNA. Translation: BAE40091.1.
AK170252 mRNA. Translation: BAE41662.1.
AK170448 mRNA. Translation: BAE41806.1.
AK171115 mRNA. Translation: BAE42257.1.
BC024501 mRNA. Translation: AAH24501.1.
BC025036 mRNA. Translation: AAH25036.1.
U58337 mRNA. Translation: AAC53056.1. Frameshift.
CCDSiCCDS48354.1. [Q61211-1]
RefSeqiNP_001129542.1. NM_001136070.1. [Q61211-1]
NP_034839.2. NM_010709.3.
XP_006529228.1. XM_006529165.2.
UniGeneiMm.276294.

Genome annotation databases

EnsembliENSMUST00000068805; ENSMUSP00000063894; ENSMUSG00000026427. [Q61211-1]
ENSMUST00000151874; ENSMUSP00000138061; ENSMUSG00000026427. [Q61211-1]
GeneIDi16865.
KEGGimmu:16865.
UCSCiuc007cmz.2. mouse. [Q61211-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK034115 mRNA. Translation: BAC28591.1.
AK036154 mRNA. Translation: BAC29323.1.
AK046539 mRNA. Translation: BAC32777.1.
AK082748 mRNA. Translation: BAC38598.1.
AK083638 mRNA. Translation: BAC38976.1.
AK139052 mRNA. Translation: BAE23874.1.
AK161269 mRNA. Translation: BAE36281.1.
AK167980 mRNA. Translation: BAE39972.1.
AK168120 mRNA. Translation: BAE40091.1.
AK170252 mRNA. Translation: BAE41662.1.
AK170448 mRNA. Translation: BAE41806.1.
AK171115 mRNA. Translation: BAE42257.1.
BC024501 mRNA. Translation: AAH24501.1.
BC025036 mRNA. Translation: AAH25036.1.
U58337 mRNA. Translation: AAC53056.1. Frameshift.
CCDSiCCDS48354.1. [Q61211-1]
RefSeqiNP_001129542.1. NM_001136070.1. [Q61211-1]
NP_034839.2. NM_010709.3.
XP_006529228.1. XM_006529165.2.
UniGeneiMm.276294.

3D structure databases

ProteinModelPortaliQ61211.
SMRiQ61211. Positions 1-177.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000063894.

PTM databases

iPTMnetiQ61211.
PhosphoSiteiQ61211.

Proteomic databases

EPDiQ61211.
MaxQBiQ61211.
PaxDbiQ61211.
PRIDEiQ61211.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000068805; ENSMUSP00000063894; ENSMUSG00000026427. [Q61211-1]
ENSMUST00000151874; ENSMUSP00000138061; ENSMUSG00000026427. [Q61211-1]
GeneIDi16865.
KEGGimmu:16865.
UCSCiuc007cmz.2. mouse. [Q61211-1]

Organism-specific databases

CTDi1939.
MGIiMGI:109342. Eif2d.

Phylogenomic databases

eggNOGiKOG2522. Eukaryota.
ENOG410XSAV. LUCA.
GeneTreeiENSGT00550000074865.
HOVERGENiHBG006268.
InParanoidiQ61211.
KOiK15027.
OrthoDBiEOG091G0DTH.
PhylomeDBiQ61211.
TreeFamiTF105830.

Miscellaneous databases

ChiTaRSiEif2d. mouse.
PMAP-CutDBQ61211.
PROiQ61211.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000026427.
CleanExiMM_LGTN.
ExpressionAtlasiQ61211. baseline and differential.
GenevisibleiQ61211. MM.

Family and domain databases

Gene3Di2.30.130.10. 1 hit.
InterProiIPR002478. PUA.
IPR015947. PUA-like_domain.
IPR001950. SUI1.
IPR003121. SWIB_MDM2_domain.
[Graphical view]
PfamiPF01253. SUI1. 1 hit.
[Graphical view]
SMARTiSM00359. PUA. 1 hit.
[Graphical view]
SUPFAMiSSF47592. SSF47592. 1 hit.
SSF55159. SSF55159. 1 hit.
SSF88697. SSF88697. 1 hit.
PROSITEiPS50890. PUA. 1 hit.
PS50296. SUI1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiEIF2D_MOUSE
AccessioniPrimary (citable) accession number: Q61211
Secondary accession number(s): Q3TDE0
, Q3THV5, Q3TTP4, Q8C491, Q8CBF1, Q8CC17, Q8R1I9, Q8R3M5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 22, 2005
Last modified: September 7, 2016
This is version 123 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.