Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Eukaryotic translation initiation factor 2D

Gene

Eif2d

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Translation initiation factor that is able to deliver tRNA to the P-site of the eukaryotic ribosome in a GTP-independent manner. The binding of Met-tRNA(I) occurs after the AUG codon finds its position in the P-site of 40S ribosomes, the situation that takes place during initiation complex formation on some specific RNAs. Its activity in tRNA binding with 40S subunits does not require the presence of the aminoacyl moiety. Possesses the unique ability to deliver non-Met (elongator) tRNAs into the P-site of the 40S subunit. In addition to its role in initiation, can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionInitiation factor
Biological processProtein biosynthesis

Names & Taxonomyi

Protein namesi
Recommended name:
Eukaryotic translation initiation factor 2D
Short name:
eIF2D
Alternative name(s):
Ligatin
Gene namesi
Name:Eif2d
Synonyms:Lgtn
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:109342 Eif2d

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001306121 – 570Eukaryotic translation initiation factor 2DAdd BLAST570

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei238PhosphoserineCombined sources1
Modified residuei241PhosphoserineCombined sources1
Modified residuei348PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ61211
PaxDbiQ61211
PRIDEiQ61211

PTM databases

iPTMnetiQ61211
PhosphoSitePlusiQ61211
SwissPalmiQ61211

Miscellaneous databases

PMAP-CutDBiQ61211

Expressioni

Gene expression databases

BgeeiENSMUSG00000026427
CleanExiMM_LGTN
ExpressionAtlasiQ61211 baseline and differential
GenevisibleiQ61211 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000063894

Structurei

3D structure databases

ProteinModelPortaliQ61211
SMRiQ61211
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini93 – 173PUAPROSITE-ProRule annotationAdd BLAST81
Domaini478 – 548SUI1PROSITE-ProRule annotationAdd BLAST71

Sequence similaritiesi

Belongs to the eIF2D family.Curated

Phylogenomic databases

eggNOGiKOG2522 Eukaryota
ENOG410XSAV LUCA
GeneTreeiENSGT00550000074865
HOVERGENiHBG006268
InParanoidiQ61211
KOiK15027
OrthoDBiEOG091G0DTH
PhylomeDBiQ61211
TreeFamiTF105830

Family and domain databases

Gene3Di2.30.130.10, 1 hit
InterProiView protein in InterPro
IPR002478 PUA
IPR015947 PUA-like_sf
IPR036974 PUA_sf
IPR001950 SUI1
IPR036877 SUI1_dom_sf
IPR036885 SWIB_MDM2_dom_sf
PfamiView protein in Pfam
PF01253 SUI1, 1 hit
SMARTiView protein in SMART
SM00359 PUA, 1 hit
SUPFAMiSSF47592 SSF47592, 1 hit
SSF55159 SSF55159, 1 hit
SSF88697 SSF88697, 1 hit
PROSITEiView protein in PROSITE
PS50890 PUA, 1 hit
PS50296 SUI1, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q61211-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFAKAFRVKS NTAIKGSDRR KLRADVTAAF PALGTDQISE LIPGKEELNV
60 70 80 90 100
VKLYVHKGDS VTVYTSGGNP ILFELEKNLY PTVYTLWAYP DILPTFITWP
110 120 130 140 150
LVLEKLVGGA DLMLPGVVVP PTGLPQVQQG DLCAIALVGN RAPVAIGVAA
160 170 180 190 200
MSTAQMLASG LKGKGVSVLH TYQDHLWRSG DKSSPPAIAP LDPTDSCEEK
210 220 230 240 250
VHLGLQGNLK SLTLDGEEEN GQVPLREASE DTSSRAPSQD SLDGKPLQEQ
260 270 280 290 300
MDDLLLRCFL HALKSRVKKA DLPLLTSTLL GSHMFSCCPE GQQLDIKKSS
310 320 330 340 350
YKKLSKFLQH MQQEQIVQVK ELSKGVESIV AVDWRHPRIT SFVIPEPSLT
360 370 380 390 400
SQTVQEVSRE QPYLPPDIKS LYCVPANMTQ LFLESGHKKG STLEGSEVRK
410 420 430 440 450
IITDYAKRNR LVDADNRNLV KLDPILCDCI LEKNEQHLVT KLPWDCLLTR
460 470 480 490 500
CLKNMQPAYQ VTFPGQEPIL KKGKLCPIDI TLALKTYNKK VTVVRNLETY
510 520 530 540 550
GLDPCSVAAI LQQRCQASTI VSPAPGAKDS LQVQVQGNQI HHLGQLLLEE
560 570
YRLPGKYIQG LEKAPKPGKK
Length:570
Mass (Da):62,830
Last modified:November 22, 2005 - v3
Checksum:i68DAA2768A595AC8
GO
Isoform 2 (identifier: Q61211-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     551-570: YRLPGKYIQGLEKAPKPGKK → NTGTLHLPAQYPHPHVQNKPEIPHLSCCGLPASHDSI

Note: No experimental confirmation available.
Show »
Length:587
Mass (Da):64,569
Checksum:iB7728E545EA0E496
GO

Sequence cautioni

The sequence AAC53056 differs from that shown. Reason: Frameshift at position 4.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti176 – 179LWRS → HASA in AAH24501 (PubMed:15489334).Curated4
Sequence conflicti177W → V in AAC53056 (PubMed:9070942).Curated1
Sequence conflicti249E → K in BAE36281 (PubMed:16141072).Curated1
Sequence conflicti268K → E in BAE41662 (PubMed:16141072).Curated1
Sequence conflicti289P → R in BAE40091 (PubMed:16141072).Curated1
Sequence conflicti341S → P in BAC28591 (PubMed:16141072).Curated1
Sequence conflicti549E → G in BAC29323 (PubMed:16141072).Curated1
Sequence conflicti549E → G in BAC38598 (PubMed:16141072).Curated1
Sequence conflicti549E → G (PubMed:9070942).Curated1
Sequence conflicti550 – 552EYR → IMW in BAC28591 (PubMed:16141072).Curated3

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_016233551 – 570YRLPG…KPGKK → NTGTLHLPAQYPHPHVQNKP EIPHLSCCGLPASHDSI in isoform 2. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK034115 mRNA Translation: BAC28591.1
AK036154 mRNA Translation: BAC29323.1
AK046539 mRNA Translation: BAC32777.1
AK082748 mRNA Translation: BAC38598.1
AK083638 mRNA Translation: BAC38976.1
AK139052 mRNA Translation: BAE23874.1
AK161269 mRNA Translation: BAE36281.1
AK167980 mRNA Translation: BAE39972.1
AK168120 mRNA Translation: BAE40091.1
AK170252 mRNA Translation: BAE41662.1
AK170448 mRNA Translation: BAE41806.1
AK171115 mRNA Translation: BAE42257.1
BC024501 mRNA Translation: AAH24501.1
BC025036 mRNA Translation: AAH25036.1
U58337 mRNA Translation: AAC53056.1 Frameshift.
CCDSiCCDS48354.1 [Q61211-1]
RefSeqiNP_001129542.1, NM_001136070.1 [Q61211-1]
NP_034839.2, NM_010709.3
XP_006529228.1, XM_006529165.3
UniGeneiMm.276294

Genome annotation databases

EnsembliENSMUST00000068805; ENSMUSP00000063894; ENSMUSG00000026427 [Q61211-1]
ENSMUST00000151874; ENSMUSP00000138061; ENSMUSG00000026427 [Q61211-1]
GeneIDi16865
KEGGimmu:16865
UCSCiuc007cmz.2 mouse [Q61211-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiEIF2D_MOUSE
AccessioniPrimary (citable) accession number: Q61211
Secondary accession number(s): Q3TDE0
, Q3THV5, Q3TTP4, Q8C491, Q8CBF1, Q8CC17, Q8R1I9, Q8R3M5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 22, 2005
Last modified: May 23, 2018
This is version 136 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health