Q61188 (EZH2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 117.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Histone-lysine N-methyltransferase EZH2 EC=2.1.1.43 Alternative name(s): ENX-1 Enhancer of zeste homolog 2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 746 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH2 complex, which methylates (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Compared to EZH2-containing complexes, it is more abundant in embryonic stem cells and plays a major role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXA7, HOXB6 and HOXC8. EZH2 can also methylate non-histone proteins such as the transcription factor GATA4. Ref.8 Ref.10 Ref.12 Ref.19 Ref.21 |
| Catalytic activity | S-adenosyl-L-methionine + L-lysine-[histone] = S-adenosyl-L-homocysteine + N(6)-methyl-L-lysine-[histone]. |
| Subunit structure | Component of the PRC2/EED-EZH2 complex, which includes EED, EZH2, SUZ12, RBBP4 and RBBP7 and possibly AEBP2 By similarity. The minimum components required for methyltransferase activity of the PRC2/EED-EZH2 complex are EED, EZH2 and SUZ12 By similarity. The PRC2 complex may also interact with DNMT1, DNMT3A, DNMT3B and PHF1 via the EZH2 subunit and with SIRT1 via the SUZ12 subunit By similarity. Interacts with HDAC1 and HDAC2 By similarity. Binds ATRX via the SET domain By similarity. Interacts with PRAME By similarity. Interacts with EED. Ref.5 Ref.17 Ref.19 Ref.22 Ref.23 |
| Subcellular location | Nucleus. Chromosome. Note: Localizes to the inactive X chromosome in trophoblast stem cells. Ref.7 Ref.8 Ref.9 Ref.13 Ref.15 Ref.18 |
| Tissue specificity | Present in actively dividing cells. Widely expressed in early embryos. In later embryogenesis, expression restricted to central and peripheral nervous system, liver and thymus. In adult, highest expression in spleen, testis and placenta. Lower levels in intestine and muscle and very low levels in brain and liver. No expression in heart, thyroid gland, lung and kidney. Ref.20 |
| Developmental stage | Expressed in both adult and embryo with highest levels in early embryogenesis. Expressed in the fertilized oocyte. Expression decreases during differentiation of ES cells and during senescence of MEFs. Expression increases in prostate during prostate tumor development. Ref.8 Ref.14 Ref.16 |
| Induction | Repressed by the microRNA (miRNA) miR-26a. Ref.18 |
| Post-translational modification | Phosphorylated by AKT1 By similarity. Phosphorylation by AKT1 reduces methyltransferase activity. Phosphorylation at Thr-345 by CDK1 and CDK2 promotes maintenance of H3K27me3 levels at EZH2-target loci, thus leading to epigenetic gene silencing By similarity. Sumoylated By similarity. |
| Disruption phenotype | Death early in development. Embryos cease development following implantation or initiate but fail to complete gastrulation. Ref.6 |
| Sequence similarities | Belongs to the histone-lysine methyltransferase family. EZ subfamily. Contains 1 CXC domain. Contains 1 SET domain. |
| Sequence caution | The sequence AAD54020.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Jarid2 | Q62315 | 14 | EBI-904311,EBI-493592 | |
| Mtf2 | Q02395 | 4 | EBI-904311,EBI-2531578 | |
| Suz12 | Q80U70 | 7 | EBI-904311,EBI-2526494 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform ENX-1A (identifier: Q61188-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform ENX-1B (identifier: Q61188-2) The sequence of this isoform differs from the canonical sequence as follows: 511-553: DGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSEC → G |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 746 | 746 | Histone-lysine N-methyltransferase EZH2 | PRO_0000213993 | |||||||
Regions | |||||||||||
| Domain | 503 – 605 | 103 | CXC | ||||||||
| Domain | 611 – 731 | 121 | SET | ||||||||
| Region | 1 – 340 | 340 | Interaction with DNMT1, DNMT3A and DNMT3B By similarity | ||||||||
| Region | 39 – 68 | 30 | Interaction with EED | ||||||||
| Compositional bias | 523 – 605 | 83 | Cys-rich | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 21 | 1 | Phosphoserine; by PKB/AKT1 By similarity | ||||||||
| Modified residue | 345 | 1 | Phosphothreonine; by CDK1 and CDK2 By similarity | ||||||||
| Modified residue | 366 | 1 | Phosphoserine By similarity | ||||||||
| Modified residue | 367 | 1 | Phosphothreonine By similarity | ||||||||
| Modified residue | 487 | 1 | Phosphothreonine By similarity | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 511 – 553 | 43 | DGSSN…CSSEC → G in isoform ENX-1B. | VSP_001501 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 42 | 1 | F → D: Abrogates interaction with EED. Ref.23 | ||||||||
| Mutagenesis | 45 | 1 | N → A: Abrogates interaction with EED. Ref.23 | ||||||||
| Mutagenesis | 49 | 1 | I → E: Abrogates interaction with EED. Ref.23 | ||||||||
| Mutagenesis | 56 | 1 | L → E: Abrogates interaction with EED. Ref.23 | ||||||||
| Mutagenesis | 67 | 1 | P → D: Abrogates interaction with EED. Ref.23 | ||||||||
| Mutagenesis | 68 | 1 | V → E: Abrogates interaction with EED. Ref.23 | ||||||||
| Sequence conflict | 159 – 161 | 3 | Missing in AAD54020. Ref.4 | ||||||||
| Sequence conflict | 651 | 1 | A → D in AAC52655. Ref.1 | ||||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Helix | 41 – 62 | 22 | |||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and developmental expression analysis of Enx-1, a novel mouse Polycomb group gene." Hobert O., Sures I., Ciossek T., Fuchs M., Ullrich A. Mech. Dev. 55:171-184(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Placenta. |
| [2] | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Strain: Czech II. Tissue: Mammary tumor. |
| [4] | "The murine polycomb-group genes ezh1 and ezh2 map close to hox gene clusters on mouse chromosomes 11 and 6." Laible G., Haynes A.R., Lebersorger A., O'Carroll D., Mattei M.-G., Denny P., Brown S.D.M., Jenuwein T. Mamm. Genome 10:311-314(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 134-497. Strain: 129/Sv. |
| [5] | "Point mutations in the WD40 domain of Eed block its interaction with Ezh2." Denisenko O.N., Shnyreva M., Suzuki H., Bomsztyk K. Mol. Cell. Biol. 18:5634-5642(1998) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EED. |
| [6] | "The polycomb-group gene Ezh2 is required for early mouse development." O'Carroll D., Erhardt S., Pagani M., Barton S.C., Surani M.A., Jenuwein T. Mol. Cell. Biol. 21:4330-4336(2001) [PubMed] [Europe PMC] [Abstract] Cited for: DISRUPTION PHENOTYPE. |
| [7] | "Mitotically stable association of polycomb group proteins Eed and Enx1 with the inactive X chromosome in trophoblast stem cells." Mak W., Baxter J., Silva J., Newall A.E., Otte A.P., Brockdorff N. Curr. Biol. 12:1016-1020(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [8] | "Establishment of histone H3 methylation on the inactive X chromosome requires transient recruitment of Eed-Enx1 polycomb group complexes." Silva J., Mak W., Zvetkova I., Appanah R., Nesterova T.B., Webster Z., Peters A.H.F.M., Jenuwein T., Otte A.P., Brockdorff N. Dev. Cell 4:481-495(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE. |
| [9] | "Role of histone H3 lysine 27 methylation in X inactivation." Plath K., Fang J., Mlynarczyk-Evans S.K., Cao R., Worringer K.A., Wang H., de la Cruz C.C., Otte A.P., Panning B., Zhang Y. Science 300:131-135(2003) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [10] | "The Polycomb Ezh2 methyltransferase regulates muscle gene expression and skeletal muscle differentiation." Caretti G., Di Padova M., Micales B., Lyons G.E., Sartorelli V. Genes Dev. 18:2627-2638(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [11] | Erratum Caretti G., Di Padova M., Micales B., Lyons G.E., Sartorelli V. Genes Dev. 19:768-768(2005) |
| [12] | "Imprinting along the Kcnq1 domain on mouse chromosome 7 involves repressive histone methylation and recruitment of Polycomb group complexes." Umlauf D., Goto Y., Cao R., Cerqueira F., Wagschal A., Zhang Y., Feil R. Nat. Genet. 36:1296-1300(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [13] | "Reactivation of the paternal X chromosome in early mouse embryos." Mak W., Nesterova T.B., de Napoles M., Appanah R., Yamanaka S., Otte A.P., Brockdorff N. Science 303:666-669(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [14] | "Composition and histone substrates of polycomb repressive group complexes change during cellular differentiation." Kuzmichev A., Margueron R., Vaquero A., Preissner T.S., Scher M., Kirmizis A., Ouyang X., Brockdorff N., Abate-Shen C., Farnham P.J., Reinberg D. Proc. Natl. Acad. Sci. U.S.A. 102:1859-1864(2005) [PubMed] [Europe PMC] [Abstract] Cited for: DEVELOPMENTAL STAGE. |
| [15] | "The Polycomb group protein Eed protects the inactive X-chromosome from differentiation-induced reactivation." Kalantry S., Mills K.C., Yee D., Otte A.P., Panning B., Magnuson T. Nat. Cell Biol. 8:195-202(2006) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [16] | "The Polycomb group proteins bind throughout the INK4A-ARF locus and are disassociated in senescent cells." Bracken A.P., Kleine-Kohlbrecher D., Dietrich N., Pasini D., Gargiulo G., Beekman C., Theilgaard-Moench K., Minucci S., Porse B.T., Marine J.-C., Hansen K.H., Helin K. Genes Dev. 21:525-530(2007) [PubMed] [Europe PMC] [Abstract] Cited for: DEVELOPMENTAL STAGE. |
| [17] | "Developmental regulation of Eed complex composition governs a switch in global histone modification in brain." Kim S.Y., Levenson J.M., Korsmeyer S., Sweatt J.D., Schumacher A. J. Biol. Chem. 282:9962-9972(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EED. |
| [18] | "MicroRNA-26a targets the histone methyltransferase Enhancer of Zeste homolog 2 during myogenesis." Wong C.F., Tellam R.L. J. Biol. Chem. 283:9836-9843(2008) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, INDUCTION. |
| [19] | "EZH1 mediates methylation on histone H3 lysine 27 and complements EZH2 in maintaining stem cell identity and executing pluripotency." Shen X., Liu Y., Hsu Y.-J., Fujiwara Y., Kim J., Mao X., Yuan G.-C., Orkin S.H. Mol. Cell 32:491-502(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN THE PRC2/EED-EZH1 COMPLEX. |
| [20] | "Ezh1 and Ezh2 maintain repressive chromatin through different mechanisms." Margueron R., Li G., Sarma K., Blais A., Zavadil J., Woodcock C.L., Dynlacht B.D., Reinberg D. Mol. Cell 32:503-518(2008) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [21] | "Role of hPHF1 in H3K27 methylation and Hox gene silencing." Cao R., Wang H., He J., Erdjument-Bromage H., Tempst P., Zhang Y. Mol. Cell. Biol. 28:1862-1872(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [22] | "Polycomb-like 2 associates with PRC2 and regulates transcriptional networks during mouse embryonic stem cell self-renewal and differentiation." Walker E., Chang W.Y., Hunkapiller J., Cagney G., Garcha K., Torchia J., Krogan N.J., Reiter J.F., Stanford W.L. Cell Stem Cell 6:153-166(2010) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE PRC2 COMPLEX. |
| [23] | "Structural basis of EZH2 recognition by EED." Han Z., Xing X., Hu M., Zhang Y., Liu P., Chai J. Structure 15:1306-1315(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.82 ANGSTROMS) OF 39-68 IN COMPLEX WITH EED, INTERACTION WITH EED, MUTAGENESIS OF PHE-42; ASN-45; ILE-49; LEU-56; PRO-67 AND VAL-68. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U52951 mRNA. Translation: AAC52655.1. CH466533 Genomic DNA. Translation: EDL13435.1. BC003772 mRNA. Translation: AAH03772.1. BC016391 mRNA. Translation: AAH16391.1. AF104359 Genomic DNA. Translation: AAD54020.1. Sequence problems. | ||||||||||||
| IPI | IPI00312722. IPI00468525. | ||||||||||||
| RefSeq | NP_031997.2. NM_007971.2. | ||||||||||||
| UniGene | Mm.246688. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q61188. | ||||||||||||
| SMR | Q61188. Positions 40-68, 535-728. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-29524N. | ||||||||||||
| IntAct | Q61188. 15 interactions. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q61188. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q61188. | ||||||||||||
| PRIDE | Q61188. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSMUST00000081721; ENSMUSP00000080419; ENSMUSG00000029687. ENSMUST00000092648; ENSMUSP00000090318; ENSMUSG00000029687. | ||||||||||||
| GeneID | 14056. | ||||||||||||
| KEGG | mmu:14056. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 2146. | ||||||||||||
| MGI | MGI:107940. Ezh2. | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG2940. | ||||||||||||
| GeneTree | ENSGT00700000104213. | ||||||||||||
| HOGENOM | HOG000008176. | ||||||||||||
| HOVERGEN | HBG002453. | ||||||||||||
| InParanoid | Q99L74. | ||||||||||||
| KO | K11430. | ||||||||||||
| OMA | NRDDKES. | ||||||||||||
| OrthoDB | EOG4WWRJ0. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q61188. | ||||||||||||
| Bgee | Q61188. | ||||||||||||
| CleanEx | MM_EZH2. | ||||||||||||
| Genevestigator | Q61188. | ||||||||||||
| GermOnline | ENSMUSG00000029687. Mus musculus. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR026489. CXC_dom. IPR021654. EZH2_WD-Binding. IPR001005. SANT/Myb. IPR001214. SET_dom. [Graphical view] | ||||||||||||
| Pfam | PF11616. EZH2_WD-Binding. 1 hit. PF00856. SET. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00717. SANT. 2 hits. SM00317. SET. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS51633. CXC. 1 hit. PS50280. SET. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | EZH2. mouse. | ||||||||||||
| EvolutionaryTrace | Q61188. | ||||||||||||
| NextBio | 285012. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | EZH2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q61188 Secondary accession number(s): Q99L74, Q9R090 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
