SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q61144

- PSN2_MOUSE

UniProt

Q61144 - PSN2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Presenilin-2
Gene
Psen2, Ad4h, Alg3, Ps-2, Psnl2
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Probable catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (beta-amyloid precursor protein). Requires the other members of the gamma-secretase complex to have a protease activity. May play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. May function in the cytoplasmic partitioning of proteins By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei263 – 2631 By similarity
Active sitei366 – 3661 By similarity

GO - Molecular functioni

  1. aspartic-type endopeptidase activity Source: InterPro
  2. endopeptidase activity Source: MGI
  3. protein binding Source: MGI

GO - Biological processi

  1. Notch receptor processing Source: RefGenome
  2. Notch signaling pathway Source: MGI
  3. T cell activation involved in immune response Source: MGI
  4. T cell receptor signaling pathway Source: MGI
  5. amyloid precursor protein catabolic process Source: RefGenome
  6. anagen Source: MGI
  7. beta-amyloid metabolic process Source: MGI
  8. brain morphogenesis Source: MGI
  9. calcium ion transport Source: MGI
  10. cardiac muscle contraction Source: MGI
  11. cell fate specification Source: MGI
  12. cellular protein metabolic process Source: MGI
  13. dorsal/ventral neural tube patterning Source: MGI
  14. embryonic limb morphogenesis Source: MGI
  15. endoplasmic reticulum calcium ion homeostasis Source: MGI
  16. forebrain development Source: MGI
  17. hair follicle development Source: MGI
  18. hematopoietic progenitor cell differentiation Source: MGI
  19. intracellular signal transduction Source: InterPro
  20. learning or memory Source: MGI
  21. locomotion Source: MGI
  22. lung alveolus development Source: MGI
  23. membrane protein ectodomain proteolysis Source: HGNC
  24. memory Source: MGI
  25. myeloid leukocyte differentiation Source: MGI
  26. negative regulation of apoptotic process Source: RefGenome
  27. negative regulation of apoptotic signaling pathway Source: MGI
  28. negative regulation of epidermal growth factor-activated receptor activity Source: BHF-UCL
  29. negative regulation of extrinsic apoptotic signaling pathway via death domain receptors Source: MGI
  30. negative regulation of protein binding Source: MGI
  31. negative regulation of protein complex assembly Source: MGI
  32. negative regulation of protein phosphorylation Source: MGI
  33. negative regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process Source: BHF-UCL
  34. negative regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  35. negative regulation of ubiquitin-protein transferase activity Source: BHF-UCL
  36. positive regulation of apoptotic process Source: MGI
  37. positive regulation of catalytic activity Source: HGNC
  38. positive regulation of coagulation Source: MGI
  39. positive regulation of extrinsic apoptotic signaling pathway via death domain receptors Source: MGI
  40. positive regulation of proteasomal ubiquitin-dependent protein catabolic process Source: BHF-UCL
  41. positive regulation of receptor recycling Source: BHF-UCL
  42. protein maturation Source: MGI
  43. protein processing Source: HGNC
  44. protein transport Source: MGI
  45. regulation of epidermal growth factor-activated receptor activity Source: MGI
  46. regulation of protein binding Source: MGI
  47. regulation of synaptic plasticity Source: MGI
  48. skin morphogenesis Source: BHF-UCL
  49. somitogenesis Source: MGI
  50. thymus development Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease

Keywords - Biological processi

Notch signaling pathway

Enzyme and pathway databases

ReactomeiREACT_196589. Constitutive Signaling by NOTCH1 PEST Domain Mutants.
REACT_196591. Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants.
REACT_198574. Nuclear signaling by ERBB4.
REACT_199384. Activated NOTCH1 Transmits Signal to the Nucleus.
REACT_199404. Signaling by NOTCH4.
REACT_199411. NOTCH2 Activation and Transmission of Signal to the Nucleus.
REACT_199413. Signaling by NOTCH3.
REACT_202271. NRIF signals cell death from the nucleus.
REACT_218614. Regulated proteolysis of p75NTR.

Protein family/group databases

MEROPSiA22.002.

Names & Taxonomyi

Protein namesi
Recommended name:
Presenilin-2 (EC:3.4.23.-)
Short name:
PS-2
Cleaved into the following 2 chains:
Gene namesi
Name:Psen2
Synonyms:Ad4h, Alg3, Ps-2, Psnl2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 1

Organism-specific databases

MGIiMGI:109284. Psen2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 8787Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei88 – 10821Helical; Reviewed prediction
Add
BLAST
Topological domaini109 – 13830Lumenal Reviewed prediction
Add
BLAST
Transmembranei139 – 15921Helical; Reviewed prediction
Add
BLAST
Topological domaini160 – 1667Cytoplasmic Reviewed prediction
Transmembranei167 – 18721Helical; Reviewed prediction
Add
BLAST
Topological domaini188 – 20013Lumenal Reviewed prediction
Add
BLAST
Transmembranei201 – 22121Helical; Reviewed prediction
Add
BLAST
Topological domaini222 – 2232Cytoplasmic Reviewed prediction
Transmembranei224 – 24421Helical; Reviewed prediction
Add
BLAST
Topological domaini245 – 2495Lumenal Reviewed prediction
Transmembranei250 – 27021Helical; Reviewed prediction
Add
BLAST
Topological domaini271 – 35888Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei359 – 37921Helical; Reviewed prediction
Add
BLAST
Topological domaini380 – 3889Lumenal Reviewed prediction
Transmembranei389 – 40921Helical; Reviewed prediction
Add
BLAST
Topological domaini410 – 4134Cytoplasmic Reviewed prediction
Intramembranei414 – 43421Helical; Reviewed prediction
Add
BLAST
Topological domaini435 – 44814Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. Golgi apparatus Source: HGNC
  2. Golgi membrane Source: UniProtKB-SubCell
  3. Z disc Source: MGI
  4. apical plasma membrane Source: RefGenome
  5. axon Source: RefGenome
  6. cell cortex Source: RefGenome
  7. cell surface Source: RefGenome
  8. ciliary basal body Source: MGI
  9. ciliary rootlet Source: RefGenome
  10. cytosol Source: MGI
  11. dendritic shaft Source: RefGenome
  12. endoplasmic reticulum Source: HGNC
  13. endoplasmic reticulum membrane Source: UniProtKB-SubCell
  14. growth cone Source: RefGenome
  15. integral component of plasma membrane Source: HGNC
  16. lysosomal membrane Source: RefGenome
  17. membrane Source: MGI
  18. membrane raft Source: RefGenome
  19. mitochondrial inner membrane Source: RefGenome
  20. neuromuscular junction Source: RefGenome
  21. neuronal cell body Source: MGI
  22. nucleus Source: RefGenome
  23. perinuclear region of cytoplasm Source: RefGenome
  24. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 297297Presenilin-2 NTF subunit By similarity
PRO_0000025607Add
BLAST
Chaini298 – 448151Presenilin-2 CTF subunit
PRO_0000025608Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei22 – 221Phosphoserine By similarity
Modified residuei25 – 251Phosphoserine By similarity
Modified residuei52 – 521Phosphoserine2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ61144.
PRIDEiQ61144.

PTM databases

PhosphoSiteiQ61144.

Expressioni

Tissue specificityi

Ubiquitously expressed. Highly expressed in the liver.

Gene expression databases

BgeeiQ61144.
CleanExiMM_PSEN2.
GenevestigatoriQ61144.

Interactioni

Subunit structurei

Homodimer. Component of the gamma-secretase complex, a complex composed of a presenilin homodimer (PSEN1 or PSEN2), nicastrin (NCSTN), APH1 (APH1A or APH1B) and PEN2. Such minimal complex is sufficient for secretase activity, although other components may exist. Interacts with DOCK3. Interacts with HERPUD1, FLNA, FLNB and PARL By similarity.1 Publication

Protein-protein interaction databases

BioGridi202415. 10 interactions.
IntActiQ61144. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ61144.
SMRiQ61144. Positions 298-448.

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi414 – 4163PAL

Domaini

The PAL motif is required for normal active site conformation By similarity.

Sequence similaritiesi

Belongs to the peptidase A22A family.

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG237920.
GeneTreeiENSGT00390000016593.
HOGENOMiHOG000240228.
HOVERGENiHBG011375.
InParanoidiQ61144.
KOiK04522.
OrthoDBiEOG7NGQBG.
PhylomeDBiQ61144.

Family and domain databases

InterProiIPR001493. Pept_A22A_PS2.
IPR001108. Peptidase_A22A.
IPR006639. Preselin/SPP.
[Graphical view]
PANTHERiPTHR10202. PTHR10202. 1 hit.
PTHR10202:SF11. PTHR10202:SF11. 1 hit.
PfamiPF01080. Presenilin. 1 hit.
[Graphical view]
PRINTSiPR01072. PRESENILIN.
PR01074. PRESENILIN2.
SMARTiSM00730. PSN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q61144-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLAFMASDSE EEVCDERTSL MSAESPTSRS CQEGRPGPED GESTAQWRTQ    50
ESEEDCEEDP DRYACSGAPG RPSGLEEELT LKYGAKRVIM LFVPVTLCMI 100
VVVATIKSVR FYTEKNGQLI YTPFTEDTPS VGQRLLNSVL NTLIMISVIV 150
VMTIFLVVLY KYRCYKFIHG WLIMSSLMLL FLFTYIYLGE VLKTYNVAMD 200
YPTLFLAVWN FGAVGMVCIH WKGPLVLQQA YLIVISALMA LVFIKYLPEW 250
SAWVILGAIS VYDLVAVLCP KGPLRMLVET AQERNEPIFP ALIYSSAMVW 300
TVGMAKLDPS SQGALQLPYD PEMEEDSYDS FGEPSYPEAF EAPLPGYPGE 350
ELEEEEERGV KLGLGDFIFY SVLVGKAAAT GNGDWNTTLA CFIAILIGLC 400
LTLLLLAVFK KALPALPISI TFGLIFYFST DNLVRPFMDT LASHQLYI 448
Length:448
Mass (Da):49,983
Last modified:September 26, 2003 - v3
Checksum:i54787212DCBB2C78
GO
Isoform 2 (identifier: Q61144-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     296-332: SAMVWTVGMAKLDPSSQGALQLPYDPEMEEDSYDSFG → CEWSHASARHWGVSRWPFVEAWKWAVVLISDRLYILS
     333-448: Missing.

Note: No experimental confirmation available.

Show »
Length:332
Mass (Da):37,701
Checksum:iE598A662F7EA7D0C
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei296 – 33237SAMVW…YDSFG → CEWSHASARHWGVSRWPFVE AWKWAVVLISDRLYILS in isoform 2.
VSP_008383Add
BLAST
Alternative sequencei333 – 448116Missing in isoform 2.
VSP_008384Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti40 – 401D → G in BAB29514. 1 Publication
Sequence conflicti86 – 872KR → ND in BAB29514. 1 Publication
Sequence conflicti87 – 871R → H1 Publication
Sequence conflicti87 – 871R → H1 Publication
Sequence conflicti226 – 2261V → A in AAC52937. 1 Publication
Sequence conflicti324 – 3241Missing in AAB92660. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U57324 mRNA. Translation: AAC52937.1.
U57325 mRNA. Translation: AAC53311.1.
AF038935 mRNA. Translation: AAB92660.1.
AK014706 mRNA. Translation: BAB29514.1.
BC010403 mRNA. Translation: AAH10403.1.
U49111 mRNA. Translation: AAC52935.1.
CCDSiCCDS15567.1. [Q61144-1]
RefSeqiNP_001122077.1. NM_001128605.1.
NP_035313.2. NM_011183.3.
XP_006496775.1. XM_006496712.1.
UniGeneiMm.330850.

Genome annotation databases

EnsembliENSMUST00000111104; ENSMUSP00000106733; ENSMUSG00000010609.
GeneIDi19165.
KEGGimmu:19165.
UCSCiuc007dwe.1. mouse. [Q61144-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U57324 mRNA. Translation: AAC52937.1 .
U57325 mRNA. Translation: AAC53311.1 .
AF038935 mRNA. Translation: AAB92660.1 .
AK014706 mRNA. Translation: BAB29514.1 .
BC010403 mRNA. Translation: AAH10403.1 .
U49111 mRNA. Translation: AAC52935.1 .
CCDSi CCDS15567.1. [Q61144-1 ]
RefSeqi NP_001122077.1. NM_001128605.1.
NP_035313.2. NM_011183.3.
XP_006496775.1. XM_006496712.1.
UniGenei Mm.330850.

3D structure databases

ProteinModelPortali Q61144.
SMRi Q61144. Positions 298-448.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 202415. 10 interactions.
IntActi Q61144. 1 interaction.

Chemistry

BindingDBi Q61144.

Protein family/group databases

MEROPSi A22.002.

PTM databases

PhosphoSitei Q61144.

Proteomic databases

PaxDbi Q61144.
PRIDEi Q61144.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000111104 ; ENSMUSP00000106733 ; ENSMUSG00000010609 .
GeneIDi 19165.
KEGGi mmu:19165.
UCSCi uc007dwe.1. mouse. [Q61144-2 ]

Organism-specific databases

CTDi 5664.
MGIi MGI:109284. Psen2.

Phylogenomic databases

eggNOGi NOG237920.
GeneTreei ENSGT00390000016593.
HOGENOMi HOG000240228.
HOVERGENi HBG011375.
InParanoidi Q61144.
KOi K04522.
OrthoDBi EOG7NGQBG.
PhylomeDBi Q61144.

Enzyme and pathway databases

Reactomei REACT_196589. Constitutive Signaling by NOTCH1 PEST Domain Mutants.
REACT_196591. Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants.
REACT_198574. Nuclear signaling by ERBB4.
REACT_199384. Activated NOTCH1 Transmits Signal to the Nucleus.
REACT_199404. Signaling by NOTCH4.
REACT_199411. NOTCH2 Activation and Transmission of Signal to the Nucleus.
REACT_199413. Signaling by NOTCH3.
REACT_202271. NRIF signals cell death from the nucleus.
REACT_218614. Regulated proteolysis of p75NTR.

Miscellaneous databases

ChiTaRSi PSEN2. mouse.
NextBioi 295826.
PROi Q61144.
SOURCEi Search...

Gene expression databases

Bgeei Q61144.
CleanExi MM_PSEN2.
Genevestigatori Q61144.

Family and domain databases

InterProi IPR001493. Pept_A22A_PS2.
IPR001108. Peptidase_A22A.
IPR006639. Preselin/SPP.
[Graphical view ]
PANTHERi PTHR10202. PTHR10202. 1 hit.
PTHR10202:SF11. PTHR10202:SF11. 1 hit.
Pfami PF01080. Presenilin. 1 hit.
[Graphical view ]
PRINTSi PR01072. PRESENILIN.
PR01074. PRESENILIN2.
SMARTi SM00730. PSN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Requirement of the familial Alzheimer's disease gene PS2 for apoptosis. Opposing effect of ALG-3."
    Vito P., Wolozin B., Ganjei J.K., Iwasaki K., Lacana E., D'Adamio L.
    J. Biol. Chem. 271:31025-31028(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Liver.
  2. "Molecular cloning of mouse presenilin 2 gene."
    Sahara N., Mori H., Shirasawa T.
    Submitted (DEC-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: NIH Swiss.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Head.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Mammary tumor.
  5. "Interfering with apoptosis: Ca(2+)-binding protein ALG-2 and Alzheimer's disease gene ALG-3."
    Vito P., Lacana E., D'Adamio L.
    Science 271:521-525(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 340-448 (ISOFORM 1).
    Tissue: Liver.
  6. "A novel mechanism for the regulation of amyloid precursor protein metabolism."
    Chen Q., Kimura H., Schubert D.
    J. Cell Biol. 158:79-89(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH DOCK3.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-52, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  8. "The phagosomal proteome in interferon-gamma-activated macrophages."
    Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
    Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-52, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiPSN2_MOUSE
AccessioniPrimary (citable) accession number: Q61144
Secondary accession number(s): O54977
, P97934, P97935, Q91VS3, Q9D616
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: September 26, 2003
Last modified: September 3, 2014
This is version 131 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi