Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q61144

- PSN2_MOUSE

UniProt

Q61144 - PSN2_MOUSE

Protein

Presenilin-2

Gene

Psen2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 132 (01 Oct 2014)
      Sequence version 3 (26 Sep 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Probable catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (beta-amyloid precursor protein). Requires the other members of the gamma-secretase complex to have a protease activity. May play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. May function in the cytoplasmic partitioning of proteins By similarity.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei263 – 2631By similarity
    Active sitei366 – 3661By similarity

    GO - Molecular functioni

    1. aspartic-type endopeptidase activity Source: InterPro
    2. endopeptidase activity Source: MGI
    3. protein binding Source: MGI

    GO - Biological processi

    1. amyloid precursor protein catabolic process Source: RefGenome
    2. anagen Source: MGI
    3. beta-amyloid metabolic process Source: MGI
    4. brain morphogenesis Source: MGI
    5. calcium ion transport Source: MGI
    6. cardiac muscle contraction Source: MGI
    7. cell fate specification Source: MGI
    8. cellular protein metabolic process Source: MGI
    9. dorsal/ventral neural tube patterning Source: MGI
    10. embryonic limb morphogenesis Source: MGI
    11. endoplasmic reticulum calcium ion homeostasis Source: MGI
    12. forebrain development Source: MGI
    13. hair follicle development Source: MGI
    14. hematopoietic progenitor cell differentiation Source: MGI
    15. intracellular signal transduction Source: InterPro
    16. learning or memory Source: MGI
    17. locomotion Source: MGI
    18. lung alveolus development Source: MGI
    19. membrane protein ectodomain proteolysis Source: HGNC
    20. memory Source: MGI
    21. myeloid leukocyte differentiation Source: MGI
    22. negative regulation of apoptotic process Source: RefGenome
    23. negative regulation of apoptotic signaling pathway Source: MGI
    24. negative regulation of epidermal growth factor-activated receptor activity Source: BHF-UCL
    25. negative regulation of extrinsic apoptotic signaling pathway via death domain receptors Source: MGI
    26. negative regulation of protein binding Source: MGI
    27. negative regulation of protein complex assembly Source: MGI
    28. negative regulation of protein phosphorylation Source: MGI
    29. negative regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process Source: BHF-UCL
    30. negative regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
    31. negative regulation of ubiquitin-protein transferase activity Source: BHF-UCL
    32. Notch receptor processing Source: RefGenome
    33. Notch signaling pathway Source: MGI
    34. positive regulation of apoptotic process Source: MGI
    35. positive regulation of catalytic activity Source: HGNC
    36. positive regulation of coagulation Source: MGI
    37. positive regulation of extrinsic apoptotic signaling pathway via death domain receptors Source: MGI
    38. positive regulation of proteasomal ubiquitin-dependent protein catabolic process Source: BHF-UCL
    39. positive regulation of receptor recycling Source: BHF-UCL
    40. protein maturation Source: MGI
    41. protein processing Source: HGNC
    42. protein transport Source: MGI
    43. regulation of epidermal growth factor-activated receptor activity Source: MGI
    44. regulation of protein binding Source: MGI
    45. regulation of synaptic plasticity Source: MGI
    46. skin morphogenesis Source: BHF-UCL
    47. somitogenesis Source: MGI
    48. T cell activation involved in immune response Source: MGI
    49. T cell receptor signaling pathway Source: MGI
    50. thymus development Source: MGI

    Keywords - Molecular functioni

    Hydrolase, Protease

    Keywords - Biological processi

    Notch signaling pathway

    Enzyme and pathway databases

    ReactomeiREACT_196589. Constitutive Signaling by NOTCH1 PEST Domain Mutants.
    REACT_196591. Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants.
    REACT_198574. Nuclear signaling by ERBB4.
    REACT_199384. Activated NOTCH1 Transmits Signal to the Nucleus.
    REACT_199404. Signaling by NOTCH4.
    REACT_199411. NOTCH2 Activation and Transmission of Signal to the Nucleus.
    REACT_199413. Signaling by NOTCH3.
    REACT_202271. NRIF signals cell death from the nucleus.
    REACT_218614. Regulated proteolysis of p75NTR.

    Protein family/group databases

    MEROPSiA22.002.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Presenilin-2 (EC:3.4.23.-)
    Short name:
    PS-2
    Cleaved into the following 2 chains:
    Gene namesi
    Name:Psen2
    Synonyms:Ad4h, Alg3, Ps-2, Psnl2
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 1

    Organism-specific databases

    MGIiMGI:109284. Psen2.

    Subcellular locationi

    GO - Cellular componenti

    1. apical plasma membrane Source: RefGenome
    2. axon Source: RefGenome
    3. cell cortex Source: RefGenome
    4. cell surface Source: RefGenome
    5. ciliary basal body Source: MGI
    6. ciliary rootlet Source: RefGenome
    7. cytosol Source: MGI
    8. dendritic shaft Source: RefGenome
    9. endoplasmic reticulum Source: HGNC
    10. endoplasmic reticulum membrane Source: UniProtKB-SubCell
    11. Golgi apparatus Source: HGNC
    12. Golgi membrane Source: UniProtKB-SubCell
    13. growth cone Source: RefGenome
    14. integral component of plasma membrane Source: HGNC
    15. lysosomal membrane Source: RefGenome
    16. membrane Source: MGI
    17. membrane raft Source: RefGenome
    18. mitochondrial inner membrane Source: RefGenome
    19. neuromuscular junction Source: RefGenome
    20. neuronal cell body Source: MGI
    21. nucleus Source: RefGenome
    22. perinuclear region of cytoplasm Source: RefGenome
    23. plasma membrane Source: Reactome
    24. Z disc Source: MGI

    Keywords - Cellular componenti

    Endoplasmic reticulum, Golgi apparatus, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 297297Presenilin-2 NTF subunitBy similarityPRO_0000025607Add
    BLAST
    Chaini298 – 448151Presenilin-2 CTF subunitPRO_0000025608Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei22 – 221PhosphoserineBy similarity
    Modified residuei25 – 251PhosphoserineBy similarity
    Modified residuei52 – 521Phosphoserine2 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiQ61144.
    PRIDEiQ61144.

    PTM databases

    PhosphoSiteiQ61144.

    Expressioni

    Tissue specificityi

    Ubiquitously expressed. Highly expressed in the liver.

    Gene expression databases

    BgeeiQ61144.
    CleanExiMM_PSEN2.
    GenevestigatoriQ61144.

    Interactioni

    Subunit structurei

    Homodimer. Component of the gamma-secretase complex, a complex composed of a presenilin homodimer (PSEN1 or PSEN2), nicastrin (NCSTN), APH1 (APH1A or APH1B) and PEN2. Such minimal complex is sufficient for secretase activity, although other components may exist. Interacts with DOCK3. Interacts with HERPUD1, FLNA, FLNB and PARL By similarity.By similarity

    Protein-protein interaction databases

    BioGridi202415. 10 interactions.
    IntActiQ61144. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliQ61144.
    SMRiQ61144. Positions 298-448.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 8787CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini109 – 13830LumenalSequence AnalysisAdd
    BLAST
    Topological domaini160 – 1667CytoplasmicSequence Analysis
    Topological domaini188 – 20013LumenalSequence AnalysisAdd
    BLAST
    Topological domaini222 – 2232CytoplasmicSequence Analysis
    Topological domaini245 – 2495LumenalSequence Analysis
    Topological domaini271 – 35888CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini380 – 3889LumenalSequence Analysis
    Topological domaini410 – 4134CytoplasmicSequence Analysis
    Topological domaini435 – 44814CytoplasmicSequence AnalysisAdd
    BLAST

    Intramembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Intramembranei414 – 43421HelicalSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei88 – 10821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei139 – 15921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei167 – 18721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei201 – 22121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei224 – 24421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei250 – 27021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei359 – 37921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei389 – 40921HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi414 – 4163PAL

    Domaini

    The PAL motif is required for normal active site conformation.By similarity

    Sequence similaritiesi

    Belongs to the peptidase A22A family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG237920.
    GeneTreeiENSGT00390000016593.
    HOGENOMiHOG000240228.
    HOVERGENiHBG011375.
    InParanoidiQ61144.
    KOiK04522.
    OrthoDBiEOG7NGQBG.
    PhylomeDBiQ61144.

    Family and domain databases

    InterProiIPR001493. Pept_A22A_PS2.
    IPR001108. Peptidase_A22A.
    IPR006639. Preselin/SPP.
    [Graphical view]
    PANTHERiPTHR10202. PTHR10202. 1 hit.
    PTHR10202:SF11. PTHR10202:SF11. 1 hit.
    PfamiPF01080. Presenilin. 1 hit.
    [Graphical view]
    PRINTSiPR01072. PRESENILIN.
    PR01074. PRESENILIN2.
    SMARTiSM00730. PSN. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q61144-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLAFMASDSE EEVCDERTSL MSAESPTSRS CQEGRPGPED GESTAQWRTQ    50
    ESEEDCEEDP DRYACSGAPG RPSGLEEELT LKYGAKRVIM LFVPVTLCMI 100
    VVVATIKSVR FYTEKNGQLI YTPFTEDTPS VGQRLLNSVL NTLIMISVIV 150
    VMTIFLVVLY KYRCYKFIHG WLIMSSLMLL FLFTYIYLGE VLKTYNVAMD 200
    YPTLFLAVWN FGAVGMVCIH WKGPLVLQQA YLIVISALMA LVFIKYLPEW 250
    SAWVILGAIS VYDLVAVLCP KGPLRMLVET AQERNEPIFP ALIYSSAMVW 300
    TVGMAKLDPS SQGALQLPYD PEMEEDSYDS FGEPSYPEAF EAPLPGYPGE 350
    ELEEEEERGV KLGLGDFIFY SVLVGKAAAT GNGDWNTTLA CFIAILIGLC 400
    LTLLLLAVFK KALPALPISI TFGLIFYFST DNLVRPFMDT LASHQLYI 448
    Length:448
    Mass (Da):49,983
    Last modified:September 26, 2003 - v3
    Checksum:i54787212DCBB2C78
    GO
    Isoform 2 (identifier: Q61144-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         296-332: SAMVWTVGMAKLDPSSQGALQLPYDPEMEEDSYDSFG → CEWSHASARHWGVSRWPFVEAWKWAVVLISDRLYILS
         333-448: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:332
    Mass (Da):37,701
    Checksum:iE598A662F7EA7D0C
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti40 – 401D → G in BAB29514. (PubMed:16141072)Curated
    Sequence conflicti86 – 872KR → ND in BAB29514. (PubMed:16141072)Curated
    Sequence conflicti87 – 871R → H1 PublicationCurated
    Sequence conflicti87 – 871R → H(PubMed:15489334)Curated
    Sequence conflicti226 – 2261V → A in AAC52937. (PubMed:8940094)Curated
    Sequence conflicti324 – 3241Missing in AAB92660. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei296 – 33237SAMVW…YDSFG → CEWSHASARHWGVSRWPFVE AWKWAVVLISDRLYILS in isoform 2. 1 PublicationVSP_008383Add
    BLAST
    Alternative sequencei333 – 448116Missing in isoform 2. 1 PublicationVSP_008384Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U57324 mRNA. Translation: AAC52937.1.
    U57325 mRNA. Translation: AAC53311.1.
    AF038935 mRNA. Translation: AAB92660.1.
    AK014706 mRNA. Translation: BAB29514.1.
    BC010403 mRNA. Translation: AAH10403.1.
    U49111 mRNA. Translation: AAC52935.1.
    CCDSiCCDS15567.1. [Q61144-1]
    RefSeqiNP_001122077.1. NM_001128605.1.
    NP_035313.2. NM_011183.3.
    XP_006496775.1. XM_006496712.1.
    UniGeneiMm.330850.

    Genome annotation databases

    EnsembliENSMUST00000111104; ENSMUSP00000106733; ENSMUSG00000010609.
    GeneIDi19165.
    KEGGimmu:19165.
    UCSCiuc007dwe.1. mouse. [Q61144-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U57324 mRNA. Translation: AAC52937.1 .
    U57325 mRNA. Translation: AAC53311.1 .
    AF038935 mRNA. Translation: AAB92660.1 .
    AK014706 mRNA. Translation: BAB29514.1 .
    BC010403 mRNA. Translation: AAH10403.1 .
    U49111 mRNA. Translation: AAC52935.1 .
    CCDSi CCDS15567.1. [Q61144-1 ]
    RefSeqi NP_001122077.1. NM_001128605.1.
    NP_035313.2. NM_011183.3.
    XP_006496775.1. XM_006496712.1.
    UniGenei Mm.330850.

    3D structure databases

    ProteinModelPortali Q61144.
    SMRi Q61144. Positions 298-448.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 202415. 10 interactions.
    IntActi Q61144. 1 interaction.

    Chemistry

    BindingDBi Q61144.

    Protein family/group databases

    MEROPSi A22.002.

    PTM databases

    PhosphoSitei Q61144.

    Proteomic databases

    PaxDbi Q61144.
    PRIDEi Q61144.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000111104 ; ENSMUSP00000106733 ; ENSMUSG00000010609 .
    GeneIDi 19165.
    KEGGi mmu:19165.
    UCSCi uc007dwe.1. mouse. [Q61144-2 ]

    Organism-specific databases

    CTDi 5664.
    MGIi MGI:109284. Psen2.

    Phylogenomic databases

    eggNOGi NOG237920.
    GeneTreei ENSGT00390000016593.
    HOGENOMi HOG000240228.
    HOVERGENi HBG011375.
    InParanoidi Q61144.
    KOi K04522.
    OrthoDBi EOG7NGQBG.
    PhylomeDBi Q61144.

    Enzyme and pathway databases

    Reactomei REACT_196589. Constitutive Signaling by NOTCH1 PEST Domain Mutants.
    REACT_196591. Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants.
    REACT_198574. Nuclear signaling by ERBB4.
    REACT_199384. Activated NOTCH1 Transmits Signal to the Nucleus.
    REACT_199404. Signaling by NOTCH4.
    REACT_199411. NOTCH2 Activation and Transmission of Signal to the Nucleus.
    REACT_199413. Signaling by NOTCH3.
    REACT_202271. NRIF signals cell death from the nucleus.
    REACT_218614. Regulated proteolysis of p75NTR.

    Miscellaneous databases

    ChiTaRSi PSEN2. mouse.
    NextBioi 295826.
    PROi Q61144.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q61144.
    CleanExi MM_PSEN2.
    Genevestigatori Q61144.

    Family and domain databases

    InterProi IPR001493. Pept_A22A_PS2.
    IPR001108. Peptidase_A22A.
    IPR006639. Preselin/SPP.
    [Graphical view ]
    PANTHERi PTHR10202. PTHR10202. 1 hit.
    PTHR10202:SF11. PTHR10202:SF11. 1 hit.
    Pfami PF01080. Presenilin. 1 hit.
    [Graphical view ]
    PRINTSi PR01072. PRESENILIN.
    PR01074. PRESENILIN2.
    SMARTi SM00730. PSN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Requirement of the familial Alzheimer's disease gene PS2 for apoptosis. Opposing effect of ALG-3."
      Vito P., Wolozin B., Ganjei J.K., Iwasaki K., Lacana E., D'Adamio L.
      J. Biol. Chem. 271:31025-31028(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Liver.
    2. "Molecular cloning of mouse presenilin 2 gene."
      Sahara N., Mori H., Shirasawa T.
      Submitted (DEC-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: NIH Swiss.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: C57BL/6J.
      Tissue: Head.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Mammary tumor.
    5. "Interfering with apoptosis: Ca(2+)-binding protein ALG-2 and Alzheimer's disease gene ALG-3."
      Vito P., Lacana E., D'Adamio L.
      Science 271:521-525(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 340-448 (ISOFORM 1).
      Tissue: Liver.
    6. "A novel mechanism for the regulation of amyloid precursor protein metabolism."
      Chen Q., Kimura H., Schubert D.
      J. Cell Biol. 158:79-89(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH DOCK3.
    7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-52, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.
    8. "The phagosomal proteome in interferon-gamma-activated macrophages."
      Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
      Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-52, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiPSN2_MOUSE
    AccessioniPrimary (citable) accession number: Q61144
    Secondary accession number(s): O54977
    , P97934, P97935, Q91VS3, Q9D616
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: September 26, 2003
    Last modified: October 1, 2014
    This is version 132 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. Peptidase families
      Classification of peptidase families and list of entries
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3