ID FOXF1_MOUSE Reviewed; 378 AA. AC Q61080; B2RSC1; Q61661; DT 01-NOV-1997, integrated into UniProtKB/Swiss-Prot. DT 26-MAY-2009, sequence version 2. DT 24-JAN-2024, entry version 177. DE RecName: Full=Forkhead box protein F1; DE AltName: Full=Forkhead-related protein FKHL5; DE AltName: Full=Forkhead-related transcription factor 1; DE Short=FREAC-1; DE AltName: Full=Hepatocyte nuclear factor 3 forkhead homolog 8; DE Short=HFH-8; GN Name=Foxf1; Synonyms=Fkhl5, Foxf1a, Freac1, Hfh8; OS Mus musculus (Mouse). OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; OC Murinae; Mus; Mus. OX NCBI_TaxID=10090; RN [1] RP NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND TISSUE SPECIFICITY. RC STRAIN=BALB/cJ; TISSUE=Lung; RX PubMed=7958446; DOI=10.1006/dbio.1994.1307; RA Clevidence D.E., Overdier D.G., Peterson R.S., Porcella A., Ye H., RA Paulson K.E., Costa R.H.; RT "Members of the HNF-3/forkhead family of transcription factors exhibit RT distinct cellular expression patterns in lung and regulate the surfactant RT protein B promoter."; RL Dev. Biol. 166:195-209(1994). RN [2] RP NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND TISSUE SPECIFICITY. RC STRAIN=129/Sv; TISSUE=Lung; RX PubMed=11313147; DOI=10.1016/s0378-1119(01)00400-0; RA Chang V.W.H., Ho Y.S.; RT "Structural characterization of the mouse Foxf1a gene."; RL Gene 267:201-211(2001). RN [3] RP NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. RC TISSUE=Lung; RX PubMed=15489334; DOI=10.1101/gr.2596504; RG The MGC Project Team; RT "The status, quality, and expansion of the NIH full-length cDNA project: RT the Mammalian Gene Collection (MGC)."; RL Genome Res. 14:2121-2127(2004). RN [4] RP NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 26-378. RC STRAIN=129; RX PubMed=8626802; DOI=10.1074/jbc.271.8.4482; RA Hellqvist M., Mahlapuu M., Samuelsson L., Enerbaeck S., Carlsson P.; RT "Differential activation of lung-specific genes by two forkhead proteins, RT FREAC-1 and FREAC-2."; RL J. Biol. Chem. 271:4482-4490(1996). CC -!- FUNCTION: Probable transcription activator for a number of lung- CC specific genes. {ECO:0000250}. CC -!- SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-ProRule:PRU00089}. CC -!- TISSUE SPECIFICITY: Expressed primarily in lung in alveolar type II CC pneumocyte cells, and to a lesser extent in placenta, stomach, CC intestine and colon. {ECO:0000269|PubMed:11313147, CC ECO:0000269|PubMed:7958446}. CC -!- DOMAIN: Activation domains C-terminal of (and distinct from) the CC forkhead domains are necessary for transcriptional activation. CC {ECO:0000250}. CC -!- CAUTION: It is uncertain whether Met-1 or Met-26 is the initiator. CC {ECO:0000305}. CC -!- SEQUENCE CAUTION: CC Sequence=AAI38806.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305}; CC Sequence=AAI38807.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305}; CC Sequence=AAK35051.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305}; CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR EMBL; L35949; AAA64885.1; -; Genomic_DNA. DR EMBL; AF346834; AAK35051.1; ALT_INIT; Genomic_DNA. DR EMBL; BC138805; AAI38806.1; ALT_INIT; mRNA. DR EMBL; BC138806; AAI38807.1; ALT_INIT; mRNA. DR EMBL; U42556; AAC52445.1; -; Genomic_DNA. DR CCDS; CCDS22722.2; -. DR PIR; I49735; I49735. DR RefSeq; NP_034556.2; NM_010426.2. DR AlphaFoldDB; Q61080; -. DR SMR; Q61080; -. DR BioGRID; 200290; 17. DR STRING; 10090.ENSMUSP00000137662; -. DR iPTMnet; Q61080; -. DR PhosphoSitePlus; Q61080; -. DR MaxQB; Q61080; -. DR PaxDb; 10090-ENSMUSP00000137662; -. DR ProteomicsDB; 271793; -. DR Antibodypedia; 17194; 284 antibodies from 31 providers. DR DNASU; 15227; -. DR Ensembl; ENSMUST00000181504.2; ENSMUSP00000137662.2; ENSMUSG00000042812.6. DR GeneID; 15227; -. DR KEGG; mmu:15227; -. DR UCSC; uc009nrn.2; mouse. DR AGR; MGI:1347470; -. DR CTD; 2294; -. DR MGI; MGI:1347470; Foxf1. DR VEuPathDB; HostDB:ENSMUSG00000042812; -. DR eggNOG; KOG2294; Eukaryota. DR GeneTree; ENSGT00940000161035; -. DR HOGENOM; CLU_039845_1_0_1; -. DR InParanoid; Q61080; -. DR OMA; SGVMEPH; -. DR OrthoDB; 5385885at2759; -. DR PhylomeDB; Q61080; -. DR TreeFam; TF351598; -. DR BioGRID-ORCS; 15227; 3 hits in 77 CRISPR screens. DR ChiTaRS; Foxf1; mouse. DR PRO; PR:Q61080; -. DR Proteomes; UP000000589; Chromosome 8. DR RNAct; Q61080; Protein. DR Bgee; ENSMUSG00000042812; Expressed in right lung lobe and 144 other cell types or tissues. DR GO; GO:0005654; C:nucleoplasm; TAS:Reactome. DR GO; GO:0005634; C:nucleus; IDA:MGI. DR GO; GO:0003677; F:DNA binding; ISO:MGI. DR GO; GO:0001228; F:DNA-binding transcription activator activity, RNA polymerase II-specific; ISO:MGI. DR GO; GO:0000981; F:DNA-binding transcription factor activity, RNA polymerase II-specific; IBA:GO_Central. DR GO; GO:0000978; F:RNA polymerase II cis-regulatory region sequence-specific DNA binding; IDA:MGI. DR GO; GO:0000977; F:RNA polymerase II transcription regulatory region sequence-specific DNA binding; ISO:MGI. DR GO; GO:0000976; F:transcription cis-regulatory region binding; IDA:MGI. DR GO; GO:0009887; P:animal organ morphogenesis; IMP:MGI. DR GO; GO:0001568; P:blood vessel development; ISO:MGI. DR GO; GO:0003214; P:cardiac left ventricle morphogenesis; ISO:MGI. DR GO; GO:0098609; P:cell-cell adhesion; IMP:MGI. DR GO; GO:0071345; P:cellular response to cytokine stimulus; IDA:MGI. DR GO; GO:0071407; P:cellular response to organic cyclic compound; IMP:MGI. DR GO; GO:0014822; P:detection of wounding; IMP:MGI. DR GO; GO:0007368; P:determination of left/right symmetry; IMP:MGI. DR GO; GO:0048565; P:digestive tract development; ISO:MGI. DR GO; GO:0097070; P:ductus arteriosus closure; ISO:MGI. DR GO; GO:0048566; P:embryonic digestive tract development; IGI:MGI. DR GO; GO:0048557; P:embryonic digestive tract morphogenesis; ISO:MGI. DR GO; GO:0048613; P:embryonic ectodermal digestive tract morphogenesis; ISO:MGI. DR GO; GO:0048617; P:embryonic foregut morphogenesis; IMP:MGI. DR GO; GO:0003197; P:endocardial cushion development; ISO:MGI. DR GO; GO:0061030; P:epithelial cell differentiation involved in mammary gland alveolus development; IGI:MGI. DR GO; GO:0060441; P:epithelial tube branching involved in lung morphogenesis; IMP:MGI. DR GO; GO:0045198; P:establishment of epithelial cell apical/basal polarity; IGI:MGI. DR GO; GO:0030198; P:extracellular matrix organization; IGI:MGI. DR GO; GO:0007507; P:heart development; ISO:MGI. DR GO; GO:0001701; P:in utero embryonic development; IMP:MGI. DR GO; GO:0048371; P:lateral mesodermal cell differentiation; IMP:MGI. DR GO; GO:0048286; P:lung alveolus development; IMP:MGI. DR GO; GO:0030324; P:lung development; IMP:MGI. DR GO; GO:0060463; P:lung lobe morphogenesis; IMP:MGI. DR GO; GO:0060425; P:lung morphogenesis; IMP:MGI. DR GO; GO:0060426; P:lung vasculature development; ISO:MGI. DR GO; GO:0090131; P:mesenchyme migration; IMP:MGI. DR GO; GO:0007498; P:mesoderm development; IMP:MGI. DR GO; GO:0048333; P:mesodermal cell differentiation; IMP:MGI. DR GO; GO:0007494; P:midgut development; ISO:MGI. DR GO; GO:0001763; P:morphogenesis of a branching structure; ISO:MGI. DR GO; GO:0050728; P:negative regulation of inflammatory response; IMP:MGI. DR GO; GO:0043305; P:negative regulation of mast cell degranulation; IMP:MGI. DR GO; GO:0000122; P:negative regulation of transcription by RNA polymerase II; IMP:MGI. DR GO; GO:0031016; P:pancreas development; ISO:MGI. DR GO; GO:0030335; P:positive regulation of cell migration; IMP:MGI. DR GO; GO:0010811; P:positive regulation of cell-substrate adhesion; IMP:MGI. DR GO; GO:0045893; P:positive regulation of DNA-templated transcription; ISO:MGI. DR GO; GO:0002053; P:positive regulation of mesenchymal cell proliferation; IMP:MGI. DR GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; IDA:MGI. DR GO; GO:0006357; P:regulation of transcription by RNA polymerase II; IBA:GO_Central. DR GO; GO:0030323; P:respiratory tube development; ISO:MGI. DR GO; GO:0060461; P:right lung morphogenesis; IMP:MGI. DR GO; GO:0051145; P:smooth muscle cell differentiation; IMP:MGI. DR GO; GO:0007224; P:smoothened signaling pathway; IDA:MGI. DR GO; GO:0001756; P:somitogenesis; IMP:MGI. DR GO; GO:0060438; P:trachea development; IMP:MGI. DR GO; GO:0072189; P:ureter development; ISO:MGI. DR GO; GO:0001570; P:vasculogenesis; IMP:MGI. DR GO; GO:0060841; P:venous blood vessel development; ISO:MGI. DR CDD; cd20049; FH_FOXF1; 1. DR Gene3D; 1.10.10.10; Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain; 1. DR InterPro; IPR001766; Fork_head_dom. DR InterPro; IPR018122; TF_fork_head_CS_1. DR InterPro; IPR030456; TF_fork_head_CS_2. DR InterPro; IPR036388; WH-like_DNA-bd_sf. DR InterPro; IPR036390; WH_DNA-bd_sf. DR PANTHER; PTHR46262; FORKHEAD BOX PROTEIN BINIOU; 1. DR PANTHER; PTHR46262:SF1; FORKHEAD BOX PROTEIN F1; 1. DR Pfam; PF00250; Forkhead; 1. DR PRINTS; PR00053; FORKHEAD. DR SMART; SM00339; FH; 1. DR SUPFAM; SSF46785; Winged helix' DNA-binding domain; 1. DR PROSITE; PS00657; FORK_HEAD_1; 1. DR PROSITE; PS00658; FORK_HEAD_2; 1. DR PROSITE; PS50039; FORK_HEAD_3; 1. DR Genevisible; Q61080; MM. PE 2: Evidence at transcript level; KW Activator; DNA-binding; Nucleus; Reference proteome; Transcription; KW Transcription regulation. FT CHAIN 1..378 FT /note="Forkhead box protein F1" FT /id="PRO_0000091833" FT DNA_BIND 47..138 FT /note="Fork-head" FT /evidence="ECO:0000255|PROSITE-ProRule:PRU00089" FT REGION 1..45 FT /note="Disordered" FT /evidence="ECO:0000256|SAM:MobiDB-lite" FT CONFLICT 32..44 FT /note="GPTKAKKTNAGVR -> PHQGQEDQRRRA (in Ref. 2; AAA64885)" FT /evidence="ECO:0000305" FT CONFLICT 232..272 FT /note="AGEYPHHDSSVPASPLLPAGAGGVMEPHAVYSSSAAAWPPA -> GRGVPAP FT RQLGARFTAARPAPAESWSRTPFTPALQQPGRP (in Ref. 2; AAA64885)" FT /evidence="ECO:0000305" SQ SEQUENCE 378 AA; 39958 MW; 180B6CF40D5FC858 CRC64; MSAPDKQQPP HGGGTGGGGG AGGQAMDPAA AGPTKAKKTN AGVRRPEKPP YSYIALIVMA IQSSPSKRLT LSEIYQFLQA RFPFFRGAYQ GWKNSVRHNL SLNECFIKLP KGLGRPGKGH YWTIDPASEF MFEEGSFRRR PRGFRRKCQA LKPVYSMVNG LGFNHLPDTY GFQGSGGLSC APNSLALEGG LGMMNGHLAG NVDGMALPSH SVPHLPSNGG HSYMGGCGGS AAGEYPHHDS SVPASPLLPA GAGGVMEPHA VYSSSAAAWP PAASAALNSG ASYIKQQPLS PCNPAANPLS GSISTHSLEQ PYLHQNSHNG PAELQGIPRY HSQSPSMCDR KEFVFSFNAM ASSSMHTTGG GSYYHQQVTY QDIKPCVM //