Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q61003 (CD6_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 113. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
T-cell differentiation antigen CD6
Alternative name(s):
CD_antigen=CD6
Gene names
Name:Cd6
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length665 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Involved in cell adhesion. Binds to CD166.

Subcellular location

Membrane; Single-pass type I membrane protein.

Tissue specificity

Expressed predominantly in thymus, lymph node and spleen.

Post-translational modification

Phosphorylated By similarity.

Sequence similarities

Contains 3 SRCR domains.

Ontologies

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q61003-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q61003-2)

The sequence of this isoform differs from the canonical sequence as follows:
     557-586: NSDSSTSSEEGYCNDPSSKPPPWNSQAFYS → KDKASGVRAESWVEQTGSGHFLGVVKGHAG
     587-665: Missing.
Isoform 3 (identifier: Q61003-3)

The sequence of this isoform differs from the canonical sequence as follows:
     461-500: APMLFIQPRVPADSDSSSDSDYEHYDFSSQPPVALTTFYN → D

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1616 Potential
Chain17 – 665649T-cell differentiation antigen CD6
PRO_0000033228

Regions

Topological domain17 – 398382Extracellular Potential
Transmembrane399 – 41921Helical; Potential
Topological domain420 – 665246Cytoplasmic Potential
Domain45 – 155111SRCR 1
Domain160 – 259100SRCR 2
Domain264 – 36097SRCR 3

Amino acid modifications

Glycosylation291N-linked (GlcNAc...) Potential
Glycosylation341N-linked (GlcNAc...) Potential
Glycosylation491N-linked (GlcNAc...) Potential
Glycosylation1111N-linked (GlcNAc...) Potential
Glycosylation1171N-linked (GlcNAc...) Potential
Glycosylation2281N-linked (GlcNAc...) Potential
Glycosylation3441N-linked (GlcNAc...) Potential
Glycosylation3671N-linked (GlcNAc...) Potential
Disulfide bond69 ↔ 143 By similarity
Disulfide bond82 ↔ 154 By similarity
Disulfide bond128 ↔ 136 By similarity
Disulfide bond185 ↔ 248 By similarity
Disulfide bond198 ↔ 258 By similarity
Disulfide bond229 ↔ 239 By similarity
Disulfide bond289 ↔ 349 By similarity
Disulfide bond302 ↔ 359 By similarity
Disulfide bond329 ↔ 339 By similarity

Natural variations

Alternative sequence461 – 50040APMLF…TTFYN → D in isoform 3.
VSP_006224
Alternative sequence557 – 58630NSDSS…QAFYS → KDKASGVRAESWVEQTGSGH FLGVVKGHAG in isoform 2.
VSP_006225
Alternative sequence587 – 66579Missing in isoform 2.
VSP_006226

Experimental info

Sequence conflict51L → F in AAA64867. Ref.2
Sequence conflict81A → T in AAA64867. Ref.2
Sequence conflict1941A → D in AAA81383. Ref.1
Sequence conflict1941A → D in AAA81384. Ref.1
Sequence conflict316 – 3172GL → AV in AAA81383. Ref.1
Sequence conflict316 – 3172GL → AV in AAA81384. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 27, 2011. Version 2.
Checksum: 8FF16DB37494D54F

FASTA66572,255
        10         20         30         40         50         60 
MWLFLGIAGL LTAVLSGLPS PAPSGQHKNG TIPNMTLDLE ERLGIRLVNG SSRCSGSVKV 

        70         80         90        100        110        120 
LLESWEPVCA AHWNRAATEA VCKALNCGDS GKVTYLMPPT SELPPGATSG NTSSAGNTTW 

       130        140        150        160        170        180 
ARAPTERCRG ANWQFCKVQD QECSSDRRLV WVTCAENQAV RLVDGSSRCA GRVEMLEHGE 

       190        200        210        220        230        240 
WGTVCDDTWD LQDAHVVCKQ LKCGWAVKAL AGLHFTPGQG PIHRDQVNCS GTEAYLWDCP 

       250        260        270        280        290        300 
GRPGDQYCGH KEDAGVVCSE HQSWRLTGGI DSCEGQVEVY FRGVWSTVCD SEWYPSEAKV 

       310        320        330        340        350        360 
LCRSLGCGSA VARPRGLPHS LDGRMYYSCK GQEPALSTCS WRFNNSNLCS QSRAARVVCS 

       370        380        390        400        410        420 
GSQRHLNLST SEVPSRVPVT IESSVPVSVK DKDSQGLTLL ILCIVLGILL LVSTIFIVIL 

       430        440        450        460        470        480 
LLRAKGQYAL PASVNHQQLS TANQAGINNY HPVPITIAKE APMLFIQPRV PADSDSSSDS 

       490        500        510        520        530        540 
DYEHYDFSSQ PPVALTTFYN SQRHRVTEEE AQQNRFQMPP LEEGLEELHV SHIPAADPRP 

       550        560        570        580        590        600 
CVADVPSRGS QYHVRNNSDS STSSEEGYCN DPSSKPPPWN SQAFYSEKSP LTEQPPNLEL 

       610        620        630        640        650        660 
AGSPAVFSGP SADDSSSTSS GEWYQNFQPP PQHPPAEQFE CPGPPGPQTD SIDDDEEDYD 


DIGAA 

« Hide

Isoform 2 [UniParc].

Checksum: C226D60556B8B8C6
Show »

FASTA58663,726
Isoform 3 [UniParc].

Checksum: 65D37F72AFA14476
Show »

FASTA62667,892

References

« Hide 'large scale' references
[1]"Identification of a mouse protein homologous to the human CD6 T cell surface protein and sequence of the corresponding cDNA."
Robinson W.H., Prohaska S.S., Santoro J.C., Robinson H.L., Parnes J.R.
J. Immunol. 155:4739-4748(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
Tissue: Thymocyte.
[2]"Cloning and characterization of murine CD6."
Whitney G., Bowen M., Neubauer M., Aruffo A.
Mol. Immunol. 32:89-92(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
[3]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
Strain: C57BL/6J.
Tissue: Thymus.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U37543 mRNA. Translation: AAA81383.1.
U37544 mRNA. Translation: AAA81384.1.
U12434 mRNA. Translation: AAA64867.1.
AK030822 mRNA. Translation: BAC27147.1.
AK030823 mRNA. Translation: BAC27148.1.
PIRI49100.
RefSeqNP_001032890.1. NM_001037801.2.
NP_033982.3. NM_009852.3.
UniGeneMm.290897.

3D structure databases

ProteinModelPortalQ61003.
SMRQ61003. Positions 160-263, 265-360.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ61003.

Proteomic databases

PaxDbQ61003.
PRIDEQ61003.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000039043; ENSMUSP00000046861; ENSMUSG00000024670. [Q61003-3]
ENSMUST00000080292; ENSMUSP00000079172; ENSMUSG00000024670. [Q61003-1]
GeneID12511.
KEGGmmu:12511.
UCSCuc008gqy.1. mouse. [Q61003-1]
uc008gqz.1. mouse. [Q61003-3]

Organism-specific databases

CTD923.
MGIMGI:103566. Cd6.

Phylogenomic databases

eggNOGNOG76003.
GeneTreeENSGT00740000115025.
HOGENOMHOG000137917.
HOVERGENHBG005289.
InParanoidQ8BGK1.
KOK06456.
OMAGEDYCNS.
OrthoDBEOG7DRJ2P.
TreeFamTF329295.

Gene expression databases

ArrayExpressQ61003.
BgeeQ61003.
CleanExMM_CD6.
GenevestigatorQ61003.

Family and domain databases

InterProIPR001190. SRCR.
IPR017448. Srcr_rcpt-rel.
[Graphical view]
PfamPF00530. SRCR. 3 hits.
[Graphical view]
PRINTSPR00258. SPERACTRCPTR.
SMARTSM00202. SR. 3 hits.
[Graphical view]
SUPFAMSSF56487. SSF56487. 3 hits.
PROSITEPS50287. SRCR_2. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

NextBio281490.
PROQ61003.
SOURCESearch...

Entry information

Entry nameCD6_MOUSE
AccessionPrimary (citable) accession number: Q61003
Secondary accession number(s): Q60679, Q61004, Q8BGK1
Entry history
Integrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: July 27, 2011
Last modified: March 19, 2014
This is version 113 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot