Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q61003

- CD6_MOUSE

UniProt

Q61003 - CD6_MOUSE

Protein

T-cell differentiation antigen CD6

Gene

Cd6

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 118 (01 Oct 2014)
      Sequence version 2 (27 Jul 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Involved in cell adhesion. Binds to CD166.

    GO - Molecular functioni

    1. protein binding Source: MGI
    2. scavenger receptor activity Source: InterPro

    GO - Biological processi

    1. cell adhesion Source: UniProtKB-KW

    Keywords - Biological processi

    Cell adhesion

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    T-cell differentiation antigen CD6
    Alternative name(s):
    CD_antigen: CD6
    Gene namesi
    Name:Cd6
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 19

    Organism-specific databases

    MGIiMGI:103566. Cd6.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1616Sequence AnalysisAdd
    BLAST
    Chaini17 – 665649T-cell differentiation antigen CD6PRO_0000033228Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi29 – 291N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi34 – 341N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi49 – 491N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi69 ↔ 143PROSITE-ProRule annotation
    Disulfide bondi82 ↔ 154PROSITE-ProRule annotation
    Glycosylationi111 – 1111N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi117 – 1171N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi128 ↔ 136PROSITE-ProRule annotation
    Disulfide bondi185 ↔ 248PROSITE-ProRule annotation
    Disulfide bondi198 ↔ 258PROSITE-ProRule annotation
    Glycosylationi228 – 2281N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi229 ↔ 239PROSITE-ProRule annotation
    Disulfide bondi289 ↔ 349PROSITE-ProRule annotation
    Disulfide bondi302 ↔ 359PROSITE-ProRule annotation
    Disulfide bondi329 ↔ 339PROSITE-ProRule annotation
    Glycosylationi344 – 3441N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi367 – 3671N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    Phosphorylated.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiQ61003.
    PRIDEiQ61003.

    PTM databases

    PhosphoSiteiQ61003.

    Expressioni

    Tissue specificityi

    Expressed predominantly in thymus, lymph node and spleen.

    Gene expression databases

    ArrayExpressiQ61003.
    BgeeiQ61003.
    CleanExiMM_CD6.
    GenevestigatoriQ61003.

    Structurei

    3D structure databases

    ProteinModelPortaliQ61003.
    SMRiQ61003. Positions 160-263, 265-360.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini17 – 398382ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini420 – 665246CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei399 – 41921HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini45 – 155111SRCR 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini160 – 259100SRCR 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini264 – 36097SRCR 3PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 3 SRCR domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG76003.
    GeneTreeiENSGT00750000117352.
    HOGENOMiHOG000137917.
    HOVERGENiHBG005289.
    InParanoidiQ8BGK1.
    KOiK06456.
    OMAiGEDYCNS.
    OrthoDBiEOG7DRJ2P.
    TreeFamiTF329295.

    Family and domain databases

    Gene3Di3.10.250.10. 3 hits.
    InterProiIPR001190. SRCR.
    IPR017448. SRCR-like_dom.
    [Graphical view]
    PfamiPF00530. SRCR. 3 hits.
    [Graphical view]
    PRINTSiPR00258. SPERACTRCPTR.
    SMARTiSM00202. SR. 3 hits.
    [Graphical view]
    SUPFAMiSSF56487. SSF56487. 3 hits.
    PROSITEiPS50287. SRCR_2. 3 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: Q61003-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MWLFLGIAGL LTAVLSGLPS PAPSGQHKNG TIPNMTLDLE ERLGIRLVNG    50
    SSRCSGSVKV LLESWEPVCA AHWNRAATEA VCKALNCGDS GKVTYLMPPT 100
    SELPPGATSG NTSSAGNTTW ARAPTERCRG ANWQFCKVQD QECSSDRRLV 150
    WVTCAENQAV RLVDGSSRCA GRVEMLEHGE WGTVCDDTWD LQDAHVVCKQ 200
    LKCGWAVKAL AGLHFTPGQG PIHRDQVNCS GTEAYLWDCP GRPGDQYCGH 250
    KEDAGVVCSE HQSWRLTGGI DSCEGQVEVY FRGVWSTVCD SEWYPSEAKV 300
    LCRSLGCGSA VARPRGLPHS LDGRMYYSCK GQEPALSTCS WRFNNSNLCS 350
    QSRAARVVCS GSQRHLNLST SEVPSRVPVT IESSVPVSVK DKDSQGLTLL 400
    ILCIVLGILL LVSTIFIVIL LLRAKGQYAL PASVNHQQLS TANQAGINNY 450
    HPVPITIAKE APMLFIQPRV PADSDSSSDS DYEHYDFSSQ PPVALTTFYN 500
    SQRHRVTEEE AQQNRFQMPP LEEGLEELHV SHIPAADPRP CVADVPSRGS 550
    QYHVRNNSDS STSSEEGYCN DPSSKPPPWN SQAFYSEKSP LTEQPPNLEL 600
    AGSPAVFSGP SADDSSSTSS GEWYQNFQPP PQHPPAEQFE CPGPPGPQTD 650
    SIDDDEEDYD DIGAA 665
    Length:665
    Mass (Da):72,255
    Last modified:July 27, 2011 - v2
    Checksum:i8FF16DB37494D54F
    GO
    Isoform 2 (identifier: Q61003-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         557-586: NSDSSTSSEEGYCNDPSSKPPPWNSQAFYS → KDKASGVRAESWVEQTGSGHFLGVVKGHAG
         587-665: Missing.

    Show »
    Length:586
    Mass (Da):63,726
    Checksum:iC226D60556B8B8C6
    GO
    Isoform 3 (identifier: Q61003-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         461-500: APMLFIQPRVPADSDSSSDSDYEHYDFSSQPPVALTTFYN → D

    Show »
    Length:626
    Mass (Da):67,892
    Checksum:i65D37F72AFA14476
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti5 – 51L → F in AAA64867. (PubMed:7870060)Curated
    Sequence conflicti8 – 81A → T in AAA64867. (PubMed:7870060)Curated
    Sequence conflicti194 – 1941A → D in AAA81383. (PubMed:7594475)Curated
    Sequence conflicti194 – 1941A → D in AAA81384. (PubMed:7594475)Curated
    Sequence conflicti316 – 3172GL → AV in AAA81383. (PubMed:7594475)Curated
    Sequence conflicti316 – 3172GL → AV in AAA81384. (PubMed:7594475)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei461 – 50040APMLF…TTFYN → D in isoform 3. 1 PublicationVSP_006224Add
    BLAST
    Alternative sequencei557 – 58630NSDSS…QAFYS → KDKASGVRAESWVEQTGSGH FLGVVKGHAG in isoform 2. CuratedVSP_006225Add
    BLAST
    Alternative sequencei587 – 66579Missing in isoform 2. CuratedVSP_006226Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U37543 mRNA. Translation: AAA81383.1.
    U37544 mRNA. Translation: AAA81384.1.
    U12434 mRNA. Translation: AAA64867.1.
    AK030822 mRNA. Translation: BAC27147.1.
    AK030823 mRNA. Translation: BAC27148.1.
    CCDSiCCDS37917.1. [Q61003-1]
    CCDS50391.1. [Q61003-3]
    PIRiI49100.
    RefSeqiNP_001032890.1. NM_001037801.2. [Q61003-3]
    NP_033982.3. NM_009852.3. [Q61003-1]
    UniGeneiMm.290897.

    Genome annotation databases

    EnsembliENSMUST00000039043; ENSMUSP00000046861; ENSMUSG00000024670. [Q61003-3]
    ENSMUST00000080292; ENSMUSP00000079172; ENSMUSG00000024670. [Q61003-1]
    GeneIDi12511.
    KEGGimmu:12511.
    UCSCiuc008gqy.1. mouse. [Q61003-1]
    uc008gqz.1. mouse. [Q61003-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U37543 mRNA. Translation: AAA81383.1 .
    U37544 mRNA. Translation: AAA81384.1 .
    U12434 mRNA. Translation: AAA64867.1 .
    AK030822 mRNA. Translation: BAC27147.1 .
    AK030823 mRNA. Translation: BAC27148.1 .
    CCDSi CCDS37917.1. [Q61003-1 ]
    CCDS50391.1. [Q61003-3 ]
    PIRi I49100.
    RefSeqi NP_001032890.1. NM_001037801.2. [Q61003-3 ]
    NP_033982.3. NM_009852.3. [Q61003-1 ]
    UniGenei Mm.290897.

    3D structure databases

    ProteinModelPortali Q61003.
    SMRi Q61003. Positions 160-263, 265-360.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q61003.

    Proteomic databases

    PaxDbi Q61003.
    PRIDEi Q61003.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000039043 ; ENSMUSP00000046861 ; ENSMUSG00000024670 . [Q61003-3 ]
    ENSMUST00000080292 ; ENSMUSP00000079172 ; ENSMUSG00000024670 . [Q61003-1 ]
    GeneIDi 12511.
    KEGGi mmu:12511.
    UCSCi uc008gqy.1. mouse. [Q61003-1 ]
    uc008gqz.1. mouse. [Q61003-3 ]

    Organism-specific databases

    CTDi 923.
    MGIi MGI:103566. Cd6.

    Phylogenomic databases

    eggNOGi NOG76003.
    GeneTreei ENSGT00750000117352.
    HOGENOMi HOG000137917.
    HOVERGENi HBG005289.
    InParanoidi Q8BGK1.
    KOi K06456.
    OMAi GEDYCNS.
    OrthoDBi EOG7DRJ2P.
    TreeFami TF329295.

    Miscellaneous databases

    NextBioi 281490.
    PROi Q61003.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q61003.
    Bgeei Q61003.
    CleanExi MM_CD6.
    Genevestigatori Q61003.

    Family and domain databases

    Gene3Di 3.10.250.10. 3 hits.
    InterProi IPR001190. SRCR.
    IPR017448. SRCR-like_dom.
    [Graphical view ]
    Pfami PF00530. SRCR. 3 hits.
    [Graphical view ]
    PRINTSi PR00258. SPERACTRCPTR.
    SMARTi SM00202. SR. 3 hits.
    [Graphical view ]
    SUPFAMi SSF56487. SSF56487. 3 hits.
    PROSITEi PS50287. SRCR_2. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of a mouse protein homologous to the human CD6 T cell surface protein and sequence of the corresponding cDNA."
      Robinson W.H., Prohaska S.S., Santoro J.C., Robinson H.L., Parnes J.R.
      J. Immunol. 155:4739-4748(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
      Tissue: Thymocyte.
    2. "Cloning and characterization of murine CD6."
      Whitney G., Bowen M., Neubauer M., Aruffo A.
      Mol. Immunol. 32:89-92(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
      Strain: C57BL/6J.
      Tissue: Thymus.

    Entry informationi

    Entry nameiCD6_MOUSE
    AccessioniPrimary (citable) accession number: Q61003
    Secondary accession number(s): Q60679, Q61004, Q8BGK1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 26, 2001
    Last sequence update: July 27, 2011
    Last modified: October 1, 2014
    This is version 118 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3