SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q61003

- CD6_MOUSE

UniProt

Q61003 - CD6_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
T-cell differentiation antigen CD6
Gene
Cd6
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

Involved in cell adhesion. Binds to CD166.

GO - Molecular functioni

  1. protein binding Source: MGI
  2. scavenger receptor activity Source: InterPro

GO - Biological processi

  1. cell adhesion Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
T-cell differentiation antigen CD6
Alternative name(s):
CD_antigen: CD6
Gene namesi
Name:Cd6
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 19

Organism-specific databases

MGIiMGI:103566. Cd6.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini17 – 398382Extracellular Reviewed prediction
Add
BLAST
Transmembranei399 – 41921Helical; Reviewed prediction
Add
BLAST
Topological domaini420 – 665246Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1616 Reviewed prediction
Add
BLAST
Chaini17 – 665649T-cell differentiation antigen CD6
PRO_0000033228Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi29 – 291N-linked (GlcNAc...) Reviewed prediction
Glycosylationi34 – 341N-linked (GlcNAc...) Reviewed prediction
Glycosylationi49 – 491N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi69 ↔ 143 By similarity
Disulfide bondi82 ↔ 154 By similarity
Glycosylationi111 – 1111N-linked (GlcNAc...) Reviewed prediction
Glycosylationi117 – 1171N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi128 ↔ 136 By similarity
Disulfide bondi185 ↔ 248 By similarity
Disulfide bondi198 ↔ 258 By similarity
Glycosylationi228 – 2281N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi229 ↔ 239 By similarity
Disulfide bondi289 ↔ 349 By similarity
Disulfide bondi302 ↔ 359 By similarity
Disulfide bondi329 ↔ 339 By similarity
Glycosylationi344 – 3441N-linked (GlcNAc...) Reviewed prediction
Glycosylationi367 – 3671N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

Phosphorylated By similarity.

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ61003.
PRIDEiQ61003.

PTM databases

PhosphoSiteiQ61003.

Expressioni

Tissue specificityi

Expressed predominantly in thymus, lymph node and spleen.

Gene expression databases

ArrayExpressiQ61003.
BgeeiQ61003.
CleanExiMM_CD6.
GenevestigatoriQ61003.

Structurei

3D structure databases

ProteinModelPortaliQ61003.
SMRiQ61003. Positions 160-263, 265-360.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini45 – 155111SRCR 1
Add
BLAST
Domaini160 – 259100SRCR 2
Add
BLAST
Domaini264 – 36097SRCR 3
Add
BLAST

Sequence similaritiesi

Contains 3 SRCR domains.

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG76003.
GeneTreeiENSGT00750000117352.
HOGENOMiHOG000137917.
HOVERGENiHBG005289.
InParanoidiQ8BGK1.
KOiK06456.
OMAiGEDYCNS.
OrthoDBiEOG7DRJ2P.
TreeFamiTF329295.

Family and domain databases

Gene3Di3.10.250.10. 3 hits.
InterProiIPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view]
PfamiPF00530. SRCR. 3 hits.
[Graphical view]
PRINTSiPR00258. SPERACTRCPTR.
SMARTiSM00202. SR. 3 hits.
[Graphical view]
SUPFAMiSSF56487. SSF56487. 3 hits.
PROSITEiPS50287. SRCR_2. 3 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: Q61003-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MWLFLGIAGL LTAVLSGLPS PAPSGQHKNG TIPNMTLDLE ERLGIRLVNG    50
SSRCSGSVKV LLESWEPVCA AHWNRAATEA VCKALNCGDS GKVTYLMPPT 100
SELPPGATSG NTSSAGNTTW ARAPTERCRG ANWQFCKVQD QECSSDRRLV 150
WVTCAENQAV RLVDGSSRCA GRVEMLEHGE WGTVCDDTWD LQDAHVVCKQ 200
LKCGWAVKAL AGLHFTPGQG PIHRDQVNCS GTEAYLWDCP GRPGDQYCGH 250
KEDAGVVCSE HQSWRLTGGI DSCEGQVEVY FRGVWSTVCD SEWYPSEAKV 300
LCRSLGCGSA VARPRGLPHS LDGRMYYSCK GQEPALSTCS WRFNNSNLCS 350
QSRAARVVCS GSQRHLNLST SEVPSRVPVT IESSVPVSVK DKDSQGLTLL 400
ILCIVLGILL LVSTIFIVIL LLRAKGQYAL PASVNHQQLS TANQAGINNY 450
HPVPITIAKE APMLFIQPRV PADSDSSSDS DYEHYDFSSQ PPVALTTFYN 500
SQRHRVTEEE AQQNRFQMPP LEEGLEELHV SHIPAADPRP CVADVPSRGS 550
QYHVRNNSDS STSSEEGYCN DPSSKPPPWN SQAFYSEKSP LTEQPPNLEL 600
AGSPAVFSGP SADDSSSTSS GEWYQNFQPP PQHPPAEQFE CPGPPGPQTD 650
SIDDDEEDYD DIGAA 665
Length:665
Mass (Da):72,255
Last modified:July 27, 2011 - v2
Checksum:i8FF16DB37494D54F
GO
Isoform 2 (identifier: Q61003-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     557-586: NSDSSTSSEEGYCNDPSSKPPPWNSQAFYS → KDKASGVRAESWVEQTGSGHFLGVVKGHAG
     587-665: Missing.

Show »
Length:586
Mass (Da):63,726
Checksum:iC226D60556B8B8C6
GO
Isoform 3 (identifier: Q61003-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     461-500: APMLFIQPRVPADSDSSSDSDYEHYDFSSQPPVALTTFYN → D

Show »
Length:626
Mass (Da):67,892
Checksum:i65D37F72AFA14476
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei461 – 50040APMLF…TTFYN → D in isoform 3.
VSP_006224Add
BLAST
Alternative sequencei557 – 58630NSDSS…QAFYS → KDKASGVRAESWVEQTGSGH FLGVVKGHAG in isoform 2.
VSP_006225Add
BLAST
Alternative sequencei587 – 66579Missing in isoform 2.
VSP_006226Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti5 – 51L → F in AAA64867. 1 Publication
Sequence conflicti8 – 81A → T in AAA64867. 1 Publication
Sequence conflicti194 – 1941A → D in AAA81383. 1 Publication
Sequence conflicti194 – 1941A → D in AAA81384. 1 Publication
Sequence conflicti316 – 3172GL → AV in AAA81383. 1 Publication
Sequence conflicti316 – 3172GL → AV in AAA81384. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U37543 mRNA. Translation: AAA81383.1.
U37544 mRNA. Translation: AAA81384.1.
U12434 mRNA. Translation: AAA64867.1.
AK030822 mRNA. Translation: BAC27147.1.
AK030823 mRNA. Translation: BAC27148.1.
CCDSiCCDS37917.1. [Q61003-1]
CCDS50391.1. [Q61003-3]
PIRiI49100.
RefSeqiNP_001032890.1. NM_001037801.2. [Q61003-3]
NP_033982.3. NM_009852.3. [Q61003-1]
UniGeneiMm.290897.

Genome annotation databases

EnsembliENSMUST00000039043; ENSMUSP00000046861; ENSMUSG00000024670. [Q61003-3]
ENSMUST00000080292; ENSMUSP00000079172; ENSMUSG00000024670. [Q61003-1]
GeneIDi12511.
KEGGimmu:12511.
UCSCiuc008gqy.1. mouse. [Q61003-1]
uc008gqz.1. mouse. [Q61003-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U37543 mRNA. Translation: AAA81383.1 .
U37544 mRNA. Translation: AAA81384.1 .
U12434 mRNA. Translation: AAA64867.1 .
AK030822 mRNA. Translation: BAC27147.1 .
AK030823 mRNA. Translation: BAC27148.1 .
CCDSi CCDS37917.1. [Q61003-1 ]
CCDS50391.1. [Q61003-3 ]
PIRi I49100.
RefSeqi NP_001032890.1. NM_001037801.2. [Q61003-3 ]
NP_033982.3. NM_009852.3. [Q61003-1 ]
UniGenei Mm.290897.

3D structure databases

ProteinModelPortali Q61003.
SMRi Q61003. Positions 160-263, 265-360.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q61003.

Proteomic databases

PaxDbi Q61003.
PRIDEi Q61003.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000039043 ; ENSMUSP00000046861 ; ENSMUSG00000024670 . [Q61003-3 ]
ENSMUST00000080292 ; ENSMUSP00000079172 ; ENSMUSG00000024670 . [Q61003-1 ]
GeneIDi 12511.
KEGGi mmu:12511.
UCSCi uc008gqy.1. mouse. [Q61003-1 ]
uc008gqz.1. mouse. [Q61003-3 ]

Organism-specific databases

CTDi 923.
MGIi MGI:103566. Cd6.

Phylogenomic databases

eggNOGi NOG76003.
GeneTreei ENSGT00750000117352.
HOGENOMi HOG000137917.
HOVERGENi HBG005289.
InParanoidi Q8BGK1.
KOi K06456.
OMAi GEDYCNS.
OrthoDBi EOG7DRJ2P.
TreeFami TF329295.

Miscellaneous databases

NextBioi 281490.
PROi Q61003.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q61003.
Bgeei Q61003.
CleanExi MM_CD6.
Genevestigatori Q61003.

Family and domain databases

Gene3Di 3.10.250.10. 3 hits.
InterProi IPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view ]
Pfami PF00530. SRCR. 3 hits.
[Graphical view ]
PRINTSi PR00258. SPERACTRCPTR.
SMARTi SM00202. SR. 3 hits.
[Graphical view ]
SUPFAMi SSF56487. SSF56487. 3 hits.
PROSITEi PS50287. SRCR_2. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a mouse protein homologous to the human CD6 T cell surface protein and sequence of the corresponding cDNA."
    Robinson W.H., Prohaska S.S., Santoro J.C., Robinson H.L., Parnes J.R.
    J. Immunol. 155:4739-4748(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
    Tissue: Thymocyte.
  2. "Cloning and characterization of murine CD6."
    Whitney G., Bowen M., Neubauer M., Aruffo A.
    Mol. Immunol. 32:89-92(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Strain: C57BL/6J.
    Tissue: Thymus.

Entry informationi

Entry nameiCD6_MOUSE
AccessioniPrimary (citable) accession number: Q61003
Secondary accession number(s): Q60679, Q61004, Q8BGK1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: July 27, 2011
Last modified: July 9, 2014
This is version 117 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi