Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

T-cell differentiation antigen CD6

Gene

Cd6

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Involved in cell adhesion. Binds to CD166.

GO - Molecular functioni

  1. scavenger receptor activity Source: InterPro

GO - Biological processi

  1. cell adhesion Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
T-cell differentiation antigen CD6
Alternative name(s):
CD_antigen: CD6
Gene namesi
Name:Cd6
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 19

Organism-specific databases

MGIiMGI:103566. Cd6.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini17 – 398382ExtracellularSequence AnalysisAdd
BLAST
Transmembranei399 – 41921HelicalSequence AnalysisAdd
BLAST
Topological domaini420 – 665246CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1616Sequence AnalysisAdd
BLAST
Chaini17 – 665649T-cell differentiation antigen CD6PRO_0000033228Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi29 – 291N-linked (GlcNAc...)Sequence Analysis
Glycosylationi34 – 341N-linked (GlcNAc...)Sequence Analysis
Glycosylationi49 – 491N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi69 ↔ 143PROSITE-ProRule annotation
Disulfide bondi82 ↔ 154PROSITE-ProRule annotation
Glycosylationi111 – 1111N-linked (GlcNAc...)Sequence Analysis
Glycosylationi117 – 1171N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi128 ↔ 136PROSITE-ProRule annotation
Disulfide bondi185 ↔ 248PROSITE-ProRule annotation
Disulfide bondi198 ↔ 258PROSITE-ProRule annotation
Glycosylationi228 – 2281N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi229 ↔ 239PROSITE-ProRule annotation
Disulfide bondi289 ↔ 349PROSITE-ProRule annotation
Disulfide bondi302 ↔ 359PROSITE-ProRule annotation
Disulfide bondi329 ↔ 339PROSITE-ProRule annotation
Glycosylationi344 – 3441N-linked (GlcNAc...)Sequence Analysis
Glycosylationi367 – 3671N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

Phosphorylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ61003.
PRIDEiQ61003.

PTM databases

PhosphoSiteiQ61003.

Expressioni

Tissue specificityi

Expressed predominantly in thymus, lymph node and spleen.

Gene expression databases

BgeeiQ61003.
CleanExiMM_CD6.
ExpressionAtlasiQ61003. baseline and differential.
GenevestigatoriQ61003.

Structurei

3D structure databases

ProteinModelPortaliQ61003.
SMRiQ61003. Positions 160-263, 265-360.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini45 – 155111SRCR 1PROSITE-ProRule annotationAdd
BLAST
Domaini160 – 259100SRCR 2PROSITE-ProRule annotationAdd
BLAST
Domaini264 – 36097SRCR 3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 3 SRCR domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG76003.
GeneTreeiENSGT00760000118953.
HOGENOMiHOG000137917.
HOVERGENiHBG005289.
InParanoidiQ61003.
KOiK06456.
OMAiSVCDDTW.
OrthoDBiEOG7DRJ2P.
TreeFamiTF329295.

Family and domain databases

Gene3Di3.10.250.10. 3 hits.
InterProiIPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view]
PfamiPF00530. SRCR. 3 hits.
[Graphical view]
PRINTSiPR00258. SPERACTRCPTR.
SMARTiSM00202. SR. 3 hits.
[Graphical view]
SUPFAMiSSF56487. SSF56487. 3 hits.
PROSITEiPS50287. SRCR_2. 3 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: Q61003-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWLFLGIAGL LTAVLSGLPS PAPSGQHKNG TIPNMTLDLE ERLGIRLVNG
60 70 80 90 100
SSRCSGSVKV LLESWEPVCA AHWNRAATEA VCKALNCGDS GKVTYLMPPT
110 120 130 140 150
SELPPGATSG NTSSAGNTTW ARAPTERCRG ANWQFCKVQD QECSSDRRLV
160 170 180 190 200
WVTCAENQAV RLVDGSSRCA GRVEMLEHGE WGTVCDDTWD LQDAHVVCKQ
210 220 230 240 250
LKCGWAVKAL AGLHFTPGQG PIHRDQVNCS GTEAYLWDCP GRPGDQYCGH
260 270 280 290 300
KEDAGVVCSE HQSWRLTGGI DSCEGQVEVY FRGVWSTVCD SEWYPSEAKV
310 320 330 340 350
LCRSLGCGSA VARPRGLPHS LDGRMYYSCK GQEPALSTCS WRFNNSNLCS
360 370 380 390 400
QSRAARVVCS GSQRHLNLST SEVPSRVPVT IESSVPVSVK DKDSQGLTLL
410 420 430 440 450
ILCIVLGILL LVSTIFIVIL LLRAKGQYAL PASVNHQQLS TANQAGINNY
460 470 480 490 500
HPVPITIAKE APMLFIQPRV PADSDSSSDS DYEHYDFSSQ PPVALTTFYN
510 520 530 540 550
SQRHRVTEEE AQQNRFQMPP LEEGLEELHV SHIPAADPRP CVADVPSRGS
560 570 580 590 600
QYHVRNNSDS STSSEEGYCN DPSSKPPPWN SQAFYSEKSP LTEQPPNLEL
610 620 630 640 650
AGSPAVFSGP SADDSSSTSS GEWYQNFQPP PQHPPAEQFE CPGPPGPQTD
660
SIDDDEEDYD DIGAA
Length:665
Mass (Da):72,255
Last modified:July 27, 2011 - v2
Checksum:i8FF16DB37494D54F
GO
Isoform 2 (identifier: Q61003-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     557-586: NSDSSTSSEEGYCNDPSSKPPPWNSQAFYS → KDKASGVRAESWVEQTGSGHFLGVVKGHAG
     587-665: Missing.

Show »
Length:586
Mass (Da):63,726
Checksum:iC226D60556B8B8C6
GO
Isoform 3 (identifier: Q61003-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     461-500: APMLFIQPRVPADSDSSSDSDYEHYDFSSQPPVALTTFYN → D

Show »
Length:626
Mass (Da):67,892
Checksum:i65D37F72AFA14476
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti5 – 51L → F in AAA64867. (PubMed:7870060)Curated
Sequence conflicti8 – 81A → T in AAA64867. (PubMed:7870060)Curated
Sequence conflicti194 – 1941A → D in AAA81383. (PubMed:7594475)Curated
Sequence conflicti194 – 1941A → D in AAA81384. (PubMed:7594475)Curated
Sequence conflicti316 – 3172GL → AV in AAA81383. (PubMed:7594475)Curated
Sequence conflicti316 – 3172GL → AV in AAA81384. (PubMed:7594475)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei461 – 50040APMLF…TTFYN → D in isoform 3. 1 PublicationVSP_006224Add
BLAST
Alternative sequencei557 – 58630NSDSS…QAFYS → KDKASGVRAESWVEQTGSGH FLGVVKGHAG in isoform 2. CuratedVSP_006225Add
BLAST
Alternative sequencei587 – 66579Missing in isoform 2. CuratedVSP_006226Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U37543 mRNA. Translation: AAA81383.1.
U37544 mRNA. Translation: AAA81384.1.
U12434 mRNA. Translation: AAA64867.1.
AK030822 mRNA. Translation: BAC27147.1.
AK030823 mRNA. Translation: BAC27148.1.
CCDSiCCDS37917.1. [Q61003-1]
CCDS50391.1. [Q61003-3]
PIRiI49100.
RefSeqiNP_001032890.1. NM_001037801.2. [Q61003-3]
NP_033982.3. NM_009852.3. [Q61003-1]
UniGeneiMm.290897.

Genome annotation databases

EnsembliENSMUST00000039043; ENSMUSP00000046861; ENSMUSG00000024670. [Q61003-3]
ENSMUST00000080292; ENSMUSP00000079172; ENSMUSG00000024670. [Q61003-1]
GeneIDi12511.
KEGGimmu:12511.
UCSCiuc008gqy.1. mouse. [Q61003-1]
uc008gqz.1. mouse. [Q61003-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U37543 mRNA. Translation: AAA81383.1.
U37544 mRNA. Translation: AAA81384.1.
U12434 mRNA. Translation: AAA64867.1.
AK030822 mRNA. Translation: BAC27147.1.
AK030823 mRNA. Translation: BAC27148.1.
CCDSiCCDS37917.1. [Q61003-1]
CCDS50391.1. [Q61003-3]
PIRiI49100.
RefSeqiNP_001032890.1. NM_001037801.2. [Q61003-3]
NP_033982.3. NM_009852.3. [Q61003-1]
UniGeneiMm.290897.

3D structure databases

ProteinModelPortaliQ61003.
SMRiQ61003. Positions 160-263, 265-360.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

PhosphoSiteiQ61003.

Proteomic databases

PaxDbiQ61003.
PRIDEiQ61003.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000039043; ENSMUSP00000046861; ENSMUSG00000024670. [Q61003-3]
ENSMUST00000080292; ENSMUSP00000079172; ENSMUSG00000024670. [Q61003-1]
GeneIDi12511.
KEGGimmu:12511.
UCSCiuc008gqy.1. mouse. [Q61003-1]
uc008gqz.1. mouse. [Q61003-3]

Organism-specific databases

CTDi923.
MGIiMGI:103566. Cd6.

Phylogenomic databases

eggNOGiNOG76003.
GeneTreeiENSGT00760000118953.
HOGENOMiHOG000137917.
HOVERGENiHBG005289.
InParanoidiQ61003.
KOiK06456.
OMAiSVCDDTW.
OrthoDBiEOG7DRJ2P.
TreeFamiTF329295.

Miscellaneous databases

NextBioi281490.
PROiQ61003.
SOURCEiSearch...

Gene expression databases

BgeeiQ61003.
CleanExiMM_CD6.
ExpressionAtlasiQ61003. baseline and differential.
GenevestigatoriQ61003.

Family and domain databases

Gene3Di3.10.250.10. 3 hits.
InterProiIPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view]
PfamiPF00530. SRCR. 3 hits.
[Graphical view]
PRINTSiPR00258. SPERACTRCPTR.
SMARTiSM00202. SR. 3 hits.
[Graphical view]
SUPFAMiSSF56487. SSF56487. 3 hits.
PROSITEiPS50287. SRCR_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a mouse protein homologous to the human CD6 T cell surface protein and sequence of the corresponding cDNA."
    Robinson W.H., Prohaska S.S., Santoro J.C., Robinson H.L., Parnes J.R.
    J. Immunol. 155:4739-4748(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
    Tissue: Thymocyte.
  2. "Cloning and characterization of murine CD6."
    Whitney G., Bowen M., Neubauer M., Aruffo A.
    Mol. Immunol. 32:89-92(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Strain: C57BL/6J.
    Tissue: Thymus.

Entry informationi

Entry nameiCD6_MOUSE
AccessioniPrimary (citable) accession number: Q61003
Secondary accession number(s): Q60679, Q61004, Q8BGK1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: July 27, 2011
Last modified: January 7, 2015
This is version 120 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.