Reviewed,
UniProtKB/Swiss-Prot Q60824 (BPAEB_MOUSE)
Last modified
November 24, 2009.
Version 88.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Bullous pemphigoid antigen 1, isoforms 6/7 Short name=BPA Alternative name(s): Hemidesmosomal plaque protein Dystonia musculorum protein Short name=Dystonin | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 1678 AA. |
| Sequence status | Fragments. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Cytoskeletal linker protein. Anchors keratin-containing intermediate filaments to the inner plaque of hemidesmosomes. The proteins may self-aggregate to form filaments or a two-dimensional mesh. Ref.2 |
| Subunit structure | Homodimer. Interacts with the neuronal intermediate filament protein, Prph. Ref.2 |
| Subcellular location | Cytoplasm › cytoskeleton By similarity. |
| Sequence similarities | Belongs to the plakin or cytolinker family. UniProtKB Q03001 Contains 1 actin-binding domain. Contains 2 CH (calponin-homology) domains. Contains 11 plectin repeats. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Repeat |
| Ligand | Actin-binding |
| Gene Ontology (GO) | |
| Biological process | cell adhesion Inferred from electronic annotation. Source: UniProtKB-KW intermediate filament cytoskeleton organizationInferred from sequence or structural similarity. Source: UniProtKB |
| Cellular component | cytoplasm Inferred from sequence or structural similarity. Source: UniProtKB cytoskeletonInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | actin binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Prph | P21807 | 1 | EBI-446159,EBI-446227 | From a different organism. |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 7 Ref.1 (identifier: Q60824-2) Also known as: n2; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 Ref.3 (identifier: Q91ZU6-2) Also known as: a; The sequence of this isoform can be found in the external entry Q91ZU6-2. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Isoform 2 Ref.3 (identifier: Q91ZU6-1) Also known as: b; The sequence of this isoform can be found in the external entry Q91ZU6-1. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Isoform 3 (identifier: Q91ZU6-3) The sequence of this isoform can be found in the external entry Q91ZU6-3. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q91ZU6-4) The sequence of this isoform can be found in the external entry Q91ZU6-4. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 Ref.3 (identifier: Q91ZU8-1) Also known as: e; The sequence of this isoform can be found in the external entry Q91ZU8-1. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Isoform 6 Ref.1 (identifier: Q60824-1) Also known as: n1; The sequence of this isoform differs from the canonical sequence as follows: 1-175: Missing. 176-205: WNLPKHERSKRKIQGGSVLDPAERAVLRIA → MAGYLSPAAYMYVEEQEYLQAYEDVLERYK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | ‹1 – 1678 | ›1678 | Bullous pemphigoid antigen 1, isoforms 6/7 | PRO_0000078143 | |||||
Regions | |||||||||
| Domain | 206 – 430 | 225 | Actin-binding | ||||||
| Domain | 210 – 313 | 104 | CH 1 | ||||||
| Domain | 326 – 427 | 102 | CH 2 | ||||||
| Repeat | 1158 – 1195 | 38 | Plectin 1 | ||||||
| Repeat | 1196 – 1233 | 38 | Plectin 2 | ||||||
| Repeat | 1234 – 1269 | 36 | Plectin 3 | ||||||
| Repeat | 1270 – 1307 | 38 | Plectin 4 | ||||||
| Repeat | 1349 – 1394 | 46 | Plectin 5 | ||||||
| Repeat | 1395 – 1445 | 51 | Plectin 6 | ||||||
| Repeat | 1465 – 1504 | 40 | Plectin 7 | ||||||
| Repeat | 1505 – 1542 | 38 | Plectin 8 | ||||||
| Repeat | 1543 – 1580 | 38 | Plectin 9 | ||||||
| Repeat | 1581 – 1618 | 38 | Plectin 10 | ||||||
| Repeat | 1619 – 1656 | 38 | Plectin 11 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 175 | 175 | Missing in isoform 6. Ref.1 | VSP_050481 | |||||
| Alternative sequence | 176 – 205 | 30 | WNLPK…VLRIA → MAGYLSPAAYMYVEEQEYLQ AYEDVLERYK in isoform 6. Ref.1 | VSP_050482 | |||||
Experimental info | |||||||||
| Non-adjacent residues | 686 – 687 | 2 | |||||||
| Non-terminal residue | 1 | 1 | |||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "The mouse dystonia musculorum gene is a neural isoform of bullous pemphigoid antigen 1." Brown A., Bernier G., Mathieu M., Rossant J., Kothary R. Nat. Genet. 10:301-306(1995) [PubMed: 7670468] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-686 (ISOFORMS 6 AND 7). Tissue: Brain. |
| [2] | "The intermediate filament protein peripherin is the specific interaction partner of mouse BPAG1-n (dystonin) in neurons." Leung C.L., Sun D., Liem R.K. J. Cell Biol. 144:435-446(1999) [PubMed: 9971739] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 687-1678, FUNCTION, INTERACTION WITH PRPH. Strain: BALB/c. |
| [3] | "The BPAG1 locus: alternative splicing produces multiple isoforms with distinct cytoskeletal linker domains, including predominant isoforms in neurons and muscles." Leung C.L., Zheng M., Prater S.M., Liem R.K.H. J. Cell Biol. 154:691-697(2001) [PubMed: 11514586] [Abstract] Cited for: ALTERNATIVE SPLICING. Strain: BALB/c. Tissue: Muscle. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| U25158 mRNA. Translation: AAC52231.1. U22452 mRNA. Translation: AAC52230.1. AF115383 mRNA. Translation: AAD22959.1. | |
| IPI | IPI00277410. IPI00623531. |
| PIR | I49290. I49298. |
| RefSeq | NP_598594.2. NP_604443.2. |
| UniGene | Mm.336625 |
3D structure databases | |
| SMR | Q60824. Positions 200-433. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q60824. 3 interactions. |
| STRING | Q60824. |
Proteomic databases | |
| PRIDE | Q60824. |
Genome annotation databases | |
| Ensembl | ENSMUST00000088270; ENSMUSP00000085605; ENSMUSG00000026131; Mus musculus. [Genome view] |
| GeneID | 13518. |
| KEGG | mmu:13518. |
Organism-specific databases | |
| CTD | 13518. |
| MGI | MGI:104627. Dst. |
Phylogenomic databases | |
| HOVERGEN | Q60824. |
Gene expression databases | |
| ArrayExpress | Q60824. |
| Bgee | Q60824. |
| CleanEx | MM_DST. |
| Genevestigator | Q60824. |
| GermOnline | ENSMUSG00000026131. Mus musculus. |
Family and domain databases | |
| InterPro | IPR001589. Actinin_actin-bd_CS. IPR016146. Calponin-homology. IPR001715. Calponin_act_bd. IPR001101. Plectin_repeat. [Graphical view] |
| Gene3D | G3DSA:1.10.418.10. Calponin-homology. 2 hits. |
| Pfam | PF00307. CH. 2 hits. PF00681. Plectin. 5 hits. [Graphical view] |
| SMART | SM00033. CH. 2 hits. SM00250. PLEC. 11 hits. [Graphical view] |
| PROSITE | PS00019. ACTININ_1. 1 hit. PS00020. ACTININ_2. 1 hit. PS50021. CH. 2 hits. PS00018. EF_HAND_1. Partial match. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 284082. |
| SOURCE | Search... |
Entry information
| Entry name | BPAEB_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q60824 Secondary accession number(s): Q60845, Q9WU50 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


