Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ski-like protein

Gene

Skil

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May have regulatory role in cell division or differentiation in response to extracellular signals.By similarity

GO - Molecular functioni

GO - Biological processi

  • blastocyst formation Source: MGI
  • cell cycle arrest Source: MGI
  • lens fiber cell differentiation Source: MGI
  • lymphocyte homeostasis Source: MGI
  • negative regulation of cell differentiation Source: MGI
  • negative regulation of transcription from RNA polymerase II promoter Source: MGI
  • negative regulation of transforming growth factor beta receptor signaling pathway Source: MGI
  • positive regulation of axonogenesis Source: MGI
  • positive regulation of extrinsic apoptotic signaling pathway via death domain receptors Source: MGI
  • positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage Source: MGI
  • protein heterotrimerization Source: MGI
  • protein homotrimerization Source: MGI
  • response to antibiotic Source: Ensembl
  • response to cytokine Source: Ensembl
  • response to growth factor Source: MGI
  • skeletal muscle tissue development Source: MGI
  • spermatogenesis Source: Ensembl
  • transforming growth factor beta receptor signaling pathway Source: MGI
Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-MMU-2173795. Downregulation of SMAD2/3:SMAD4 transcriptional activity.

Names & Taxonomyi

Protein namesi
Recommended name:
Ski-like protein
Alternative name(s):
Ski-related oncogene
Ski-related protein
Gene namesi
Name:Skil
Synonyms:Skir, Sno
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:106203. Skil.

Subcellular locationi

GO - Cellular componenti

  • acrosomal vesicle Source: Ensembl
  • cytoplasm Source: MGI
  • nucleus Source: MGI
  • PML body Source: MGI
  • protein complex Source: MGI
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 675675Ski-like proteinPRO_0000129388Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki47 – 47Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei449 – 4491PhosphoserineBy similarity
Cross-linki518 – 518Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ60665.
PaxDbiQ60665.
PRIDEiQ60665.

PTM databases

iPTMnetiQ60665.
PhosphoSiteiQ60665.

Expressioni

Gene expression databases

BgeeiENSMUSG00000027660.
CleanExiMM_SKIL.
ExpressionAtlasiQ60665. baseline and differential.
GenevisibleiQ60665. MM.

Interactioni

Subunit structurei

Interacts with CPNE4 (via VWFA domain) (PubMed:12522145). Interacts with SMAD2, SMAD3 and RNF111. Interacts with WWP1 (By similarity).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi203269. 9 interactions.
STRINGi10090.ENSMUSP00000029194.

Structurei

3D structure databases

ProteinModelPortaliQ60665.
SMRiQ60665. Positions 138-235, 261-352.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili526 – 669144Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the SKI family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IFDK. Eukaryota.
ENOG410Y8AU. LUCA.
GeneTreeiENSGT00530000063040.
HOGENOMiHOG000039989.
HOVERGENiHBG006599.
InParanoidiQ60665.
KOiK18499.
OMAiMEEFYIE.
OrthoDBiEOG091G0O02.
PhylomeDBiQ60665.
TreeFamiTF324133.

Family and domain databases

Gene3Di3.10.260.20. 1 hit.
3.10.390.10. 1 hit.
InterProiIPR014890. c-SKI_SMAD4-bd_dom.
IPR009061. DNA-bd_dom_put.
IPR010919. SAND_dom-like.
IPR028373. Ski-rel_Sno.
IPR003380. Transform_Ski.
IPR023216. Tscrpt_reg_SKI_SnoN.
[Graphical view]
PANTHERiPTHR10005. PTHR10005. 1 hit.
PTHR10005:SF3. PTHR10005:SF3. 1 hit.
PfamiPF08782. c-SKI_SMAD_bind. 1 hit.
PF02437. Ski_Sno. 1 hit.
[Graphical view]
SMARTiSM01046. c-SKI_SMAD_bind. 1 hit.
[Graphical view]
SUPFAMiSSF46955. SSF46955. 1 hit.
SSF63763. SSF63763. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q60665-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MENLQSKFSL VQGSNKKLNG MEDDGSPPVK KMMTDIHANG KTLTKVKKEH
60 70 80 90 100
LDDYGDASVE PDGEHAKRNR VSLPETLNLN PSLKHTLAQF HLSSQSSLGG
110 120 130 140 150
PAAFSARYSQ ESMSPTVFLP LPSPQVLPGP LLIPSDSSTE LTQTLLEGES
160 170 180 190 200
ISCFQVGGEK RLCLPQVLNS VLREFSLQQI NTVCDELYIY CSRCTSDQLH
210 220 230 240 250
ILKVLGILPF NAPSCGLITL TDAQRLCNAL LRPRTFPQNG SILPAKSSLA
260 270 280 290 300
QLKETGSAFE VEHECLGKCQ GLFAPQFYVQ PDAPCIQCLE CCGMFAPQTF
310 320 330 340 350
VMHSHRSPDK RTCHWGFESA KWHCYLHVNQ KYLGTPEEKK LKIILEEMKE
360 370 380 390 400
KFSMRNGKRI QSKTDTPSGM ELPSWYPVIK QEGDHVPQTH SFLHPSYYLY
410 420 430 440 450
MCDKVVAPNV SLTSAASQSK EATKAETSKS TSKQSEKPHE SSQHQKTVSY
460 470 480 490 500
PDVSLEEQEK MDLKTSRELY SCLDSSISNN STSRKKSESA VCSLVRGTSK
510 520 530 540 550
RDSEDSSPLL VRDGEDDKGK IMEDVMRTYV RQQEKLNSIL QRKQQLQMEV
560 570 580 590 600
EMLSSSKAMK ELTEEQQNLQ KELESLQSEH AQRMEEFYIE QRDLEKKLEQ
610 620 630 640 650
VMQQKCTCDS TLEKDREAEY AAQLAELRQR LDHAEADRQE LQDELRQERE
660 670
ARQKLEMMIK ELKLQIGKSS KPSKD
Length:675
Mass (Da):76,359
Last modified:June 21, 2005 - v2
Checksum:iCE17BBC167693869
GO
Isoform 2 (identifier: Q60665-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     428-474: SKSTSKQSEKPHESSQHQKTVSYPDVSLEEQEKMDLKTSRELYSCLD → N

Show »
Length:629
Mass (Da):71,061
Checksum:iC58CCA2D5403F39E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti63 – 664GEHA → RAR in AAB65849 (PubMed:9207045).Curated
Sequence conflicti130 – 1301P → T in AAB65849 (PubMed:9207045).Curated
Sequence conflicti150 – 1501S → T in AAB65849 (PubMed:9207045).Curated
Sequence conflicti205 – 2051L → S in AAB65849 (PubMed:9207045).Curated
Sequence conflicti229 – 2291A → T in AAB65849 (PubMed:9207045).Curated
Sequence conflicti302 – 3032MH → ID in AAB50266 (PubMed:8834472).Curated
Sequence conflicti302 – 3032MH → ID in AAB50267 (PubMed:8834472).Curated
Sequence conflicti542 – 5421R → G in AAB50266 (PubMed:8834472).Curated
Sequence conflicti542 – 5421R → G in AAB50267 (PubMed:8834472).Curated
Sequence conflicti618 – 6181A → P in AAB50266 (PubMed:8834472).Curated
Sequence conflicti618 – 6181A → P in AAB50267 (PubMed:8834472).Curated
Sequence conflicti622 – 6221A → G in AAB65849 (PubMed:9207045).Curated
Sequence conflicti638 – 6392RQ → QR in AAB65849 (PubMed:9207045).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei428 – 47447SKSTS…YSCLD → N in isoform 2. 3 PublicationsVSP_014265Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U10530 mRNA. Translation: AAB50266.1.
U10532 mRNA. Translation: AAB50267.1.
U14655 mRNA. Translation: AAB65849.1.
BC049934 mRNA. Translation: AAH49934.1.
CCDSiCCDS38408.1. [Q60665-1]
CCDS50886.1. [Q60665-2]
RefSeqiNP_001034179.1. NM_001039090.2. [Q60665-2]
NP_035516.2. NM_011386.3. [Q60665-1]
XP_006535490.1. XM_006535427.2. [Q60665-1]
UniGeneiMm.15406.
Mm.491655.

Genome annotation databases

EnsembliENSMUST00000029194; ENSMUSP00000029194; ENSMUSG00000027660. [Q60665-1]
ENSMUST00000118204; ENSMUSP00000112413; ENSMUSG00000027660. [Q60665-1]
ENSMUST00000118470; ENSMUSP00000113256; ENSMUSG00000027660. [Q60665-2]
GeneIDi20482.
KEGGimmu:20482.
UCSCiuc008ovv.2. mouse. [Q60665-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U10530 mRNA. Translation: AAB50266.1.
U10532 mRNA. Translation: AAB50267.1.
U14655 mRNA. Translation: AAB65849.1.
BC049934 mRNA. Translation: AAH49934.1.
CCDSiCCDS38408.1. [Q60665-1]
CCDS50886.1. [Q60665-2]
RefSeqiNP_001034179.1. NM_001039090.2. [Q60665-2]
NP_035516.2. NM_011386.3. [Q60665-1]
XP_006535490.1. XM_006535427.2. [Q60665-1]
UniGeneiMm.15406.
Mm.491655.

3D structure databases

ProteinModelPortaliQ60665.
SMRiQ60665. Positions 138-235, 261-352.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi203269. 9 interactions.
STRINGi10090.ENSMUSP00000029194.

PTM databases

iPTMnetiQ60665.
PhosphoSiteiQ60665.

Proteomic databases

MaxQBiQ60665.
PaxDbiQ60665.
PRIDEiQ60665.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000029194; ENSMUSP00000029194; ENSMUSG00000027660. [Q60665-1]
ENSMUST00000118204; ENSMUSP00000112413; ENSMUSG00000027660. [Q60665-1]
ENSMUST00000118470; ENSMUSP00000113256; ENSMUSG00000027660. [Q60665-2]
GeneIDi20482.
KEGGimmu:20482.
UCSCiuc008ovv.2. mouse. [Q60665-1]

Organism-specific databases

CTDi6498.
MGIiMGI:106203. Skil.

Phylogenomic databases

eggNOGiENOG410IFDK. Eukaryota.
ENOG410Y8AU. LUCA.
GeneTreeiENSGT00530000063040.
HOGENOMiHOG000039989.
HOVERGENiHBG006599.
InParanoidiQ60665.
KOiK18499.
OMAiMEEFYIE.
OrthoDBiEOG091G0O02.
PhylomeDBiQ60665.
TreeFamiTF324133.

Enzyme and pathway databases

ReactomeiR-MMU-2173795. Downregulation of SMAD2/3:SMAD4 transcriptional activity.

Miscellaneous databases

ChiTaRSiSkil. mouse.
PROiQ60665.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000027660.
CleanExiMM_SKIL.
ExpressionAtlasiQ60665. baseline and differential.
GenevisibleiQ60665. MM.

Family and domain databases

Gene3Di3.10.260.20. 1 hit.
3.10.390.10. 1 hit.
InterProiIPR014890. c-SKI_SMAD4-bd_dom.
IPR009061. DNA-bd_dom_put.
IPR010919. SAND_dom-like.
IPR028373. Ski-rel_Sno.
IPR003380. Transform_Ski.
IPR023216. Tscrpt_reg_SKI_SnoN.
[Graphical view]
PANTHERiPTHR10005. PTHR10005. 1 hit.
PTHR10005:SF3. PTHR10005:SF3. 1 hit.
PfamiPF08782. c-SKI_SMAD_bind. 1 hit.
PF02437. Ski_Sno. 1 hit.
[Graphical view]
SMARTiSM01046. c-SKI_SMAD_bind. 1 hit.
[Graphical view]
SUPFAMiSSF46955. SSF46955. 1 hit.
SSF63763. SSF63763. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiSKIL_MOUSE
AccessioniPrimary (citable) accession number: Q60665
Secondary accession number(s): Q60702, Q78E90, Q80VK5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: June 21, 2005
Last modified: September 7, 2016
This is version 129 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.