Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q60636

- PRDM1_MOUSE

UniProt

Q60636 - PRDM1_MOUSE

Protein

PR domain zinc finger protein 1

Gene

Prdm1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 126 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcriptional repressor that binds specifically to the PRDI element in the promoter of the beta-interferon gene. Drives the maturation of B-lymphocytes into Ig secreting cells.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri606 – 62823C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri634 – 65623C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri662 – 68423C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri690 – 71223C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. histone deacetylase binding Source: MGI
    2. metal ion binding Source: UniProtKB-KW
    3. methyltransferase activity Source: UniProtKB-KW
    4. protein binding Source: IntAct
    5. sequence-specific DNA binding Source: MGI

    GO - Biological processi

    1. cell fate commitment Source: MGI
    2. embryonic placenta development Source: MGI
    3. eye photoreceptor cell development Source: MGI
    4. germ cell development Source: MGI
    5. intestinal epithelial cell development Source: MGI
    6. in utero embryonic development Source: MGI
    7. maternal placenta development Source: MGI
    8. negative regulation of B cell proliferation Source: MGI
    9. negative regulation of gene expression Source: MGI
    10. negative regulation of lipopolysaccharide-mediated signaling pathway Source: MGI
    11. negative regulation of transcription from RNA polymerase II promoter Source: MGI
    12. positive regulation of B cell differentiation Source: MGI
    13. positive regulation of gene expression Source: MGI
    14. post-embryonic development Source: MGI
    15. transcription, DNA-templated Source: UniProtKB-KW
    16. trophoblast giant cell differentiation Source: MGI

    Keywords - Molecular functioni

    Developmental protein, Methyltransferase, Repressor, Transferase

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, S-adenosyl-L-methionine, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    PR domain zinc finger protein 1 (EC:2.1.1.-)
    Alternative name(s):
    B lymphocyte-induced maturation protein 1
    Short name:
    Blimp-1
    Beta-interferon gene positive regulatory domain I-binding factor
    PR domain-containing protein 1
    Gene namesi
    Name:Prdm1
    Synonyms:Blimp1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 10

    Organism-specific databases

    MGIiMGI:99655. Prdm1.

    Subcellular locationi

    Nucleus 1 Publication. Cytoplasm By similarity

    GO - Cellular componenti

    1. cytoplasm Source: MGI
    2. nucleus Source: MGI

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Disruption phenotypei

    Early embryonic lethality. Compound heterozygotes display germ cell defects and a rudimentary or missing fifth digit of the forelimb.1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 856856PR domain zinc finger protein 1PRO_0000047758Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Cross-linki847 – 847Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)By similarity

    Post-translational modificationi

    Sumoylation at Lys-847 by PIAS1 augments transcriptional repressor activity, and is critical for plasma cell differentiation.By similarity

    Keywords - PTMi

    Isopeptide bond, Ubl conjugation

    Proteomic databases

    PaxDbiQ60636.
    PRIDEiQ60636.

    PTM databases

    PhosphoSiteiQ60636.

    Expressioni

    Tissue specificityi

    Isoform 1 is detected in bone marrow, spleen and lymph node but not in brain, heart, kidney, liver, ovary or muscle. Weak expression detected in the lung. Isoform 3 is detected only in yolk sac. Isoform 4 is detected in embryo, yolk sac, placenta, splenocytes, and activated T-cells.3 Publications

    Inductioni

    By lymphokines, specifically IL-2 AND IL-5. Up-regulated during dendritic cell maturation.

    Gene expression databases

    BgeeiQ60636.
    CleanExiMM_PRDM1.
    GenevestigatoriQ60636.

    Interactioni

    Subunit structurei

    Interacts with PRMT5.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    SUMO1P631653EBI-7000804,EBI-80140From a different organism.

    Protein-protein interaction databases

    BioGridi198355. 3 interactions.
    IntActiQ60636. 1 interaction.
    STRINGi10090.ENSMUSP00000101129.

    Structurei

    3D structure databases

    ProteinModelPortaliQ60636.
    SMRiQ60636. Positions 75-289, 556-768.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini115 – 233119SETPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni558 – 60548Interaction with PIAS1By similarityAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi351 – 39444Glu/Pro/Ser/Thr-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the class V-like SAM-binding methyltransferase superfamily.PROSITE-ProRule annotation
    Contains 4 C2H2-type zinc fingers.PROSITE-ProRule annotation
    Contains 1 SET domain.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri606 – 62823C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri634 – 65623C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri662 – 68423C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri690 – 71223C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5048.
    GeneTreeiENSGT00740000115517.
    HOGENOMiHOG000059670.
    HOVERGENiHBG053670.
    InParanoidiQ3UET9.
    OMAiTGYKTLP.
    OrthoDBiEOG7060Q3.
    PhylomeDBiQ60636.
    TreeFamiTF316545.

    Family and domain databases

    Gene3Di3.30.160.60. 5 hits.
    InterProiIPR001214. SET_dom.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    IPR016608. Znf_PRDM1.
    [Graphical view]
    PfamiPF00856. SET. 1 hit.
    [Graphical view]
    PIRSFiPIRSF013212. PRDM1. 1 hit.
    SMARTiSM00317. SET. 1 hit.
    SM00355. ZnF_C2H2. 5 hits.
    [Graphical view]
    PROSITEiPS50280. SET. 1 hit.
    PS00028. ZINC_FINGER_C2H2_1. 4 hits.
    PS50157. ZINC_FINGER_C2H2_2. 4 hits.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative promoter usage and alternative splicing. Align

    Isoform 1 (identifier: Q60636-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MREAYLRCWI FSWKNVWVRP CQRLHFKTVL LQGSLLYTAL DSYSTVQAAP    50
    KSSSGSVKFQ GLAETGIMKM DMEDADMTLW TEAEFEEKCT YIVNDHPWDS 100
    GADGGTSVQA EASLPRNLLF KYAANNSKEV IGVVSKEYIP KGTRFGPLIG 150
    EVYTNDTVPK NANRKYFWRI YSREEFHHFI DGFNEEKSNW MRYVNPAHSA 200
    REQNLAACQN GMNIYFYTIK PIPANQELLV WYCRDFAERL HYPYPGELTV 250
    INLTQTESNP KQYSSEKNEL YPKSVPKREY SVKEILKLDS NPSKRKDIYR 300
    SNISPFTLEK DMDGFRKNGS PDMPFYPRVV YPIRAPLPED FLKASLAYGM 350
    ERPTYITHSP LPSSTTPSPP ASSSPEQSLK SSSPHSSPGN TVSPLAPGLP 400
    EHRDSYSYLN VSYGSEGLGS YPGYAPAPHL PPAFIPSYNA HYPKFLLPPY 450
    GISSNGLSTM NNINGINNFS LFPRLYPVYS NLLSGSSLPH PMLNPASLPS 500
    SLPTDGARRL LPPEHPKEVL IPAPHSAFSL TGAAASMKDE SSPPSGSPTA 550
    GTAATSEHVV QPKATSSVMA APSTDGAMNL IKNKRNMTGY KTLPYPLKKQ 600
    NGKIKYECNV CAKTFGQLSN LKVHLRVHSG ERPFKCQTCN KGFTQLAHLQ 650
    KHYLVHTGEK PHECQVCHKR FSSTSNLKTH LRLHSGEKPY QCKVCPAKFT 700
    QFVHLKLHKR LHTRERPHKC AQCHKSYIHL CSLKVHLKGN CPAGPAAGLP 750
    LEDLTRINEE IERFDISDNA DRLEDMEDSV DVTSMVEKEI LAVVRKEKEE 800
    TSLKVSLQRN MGNGLLSSGC SLYESSDLSL MKLPHSNPLP LVPVKVKQET 850
    VEPMDP 856

    Note: Produced by alternative splicing.

    Length:856
    Mass (Da):95,836
    Last modified:November 1, 1996 - v1
    Checksum:iB9AC6FC2E29ECF4A
    GO
    Isoform 2 (identifier: Q60636-2) [UniParc]FASTAAdd to Basket

    Also known as: 1A

    The sequence of this isoform differs from the canonical sequence as follows:
         1-47: MREAYLRCWIFSWKNVWVRPCQRLHFKTVLLQGSLLYTALDSYSTVQ → MLDLLLEKRVGTTL

    Note: Produced by alternative splicing of isoform 1.

    Show »
    Length:823
    Mass (Da):91,729
    Checksum:i8B5904D42DDB2193
    GO
    Isoform 3 (identifier: Q60636-3) [UniParc]FASTAAdd to Basket

    Also known as: 1B

    The sequence of this isoform differs from the canonical sequence as follows:
         1-67: Missing.

    Note: Produced by alternative promoter usage of isoform 2.

    Show »
    Length:789
    Mass (Da):88,228
    Checksum:iD9C1AAA129A608C4
    GO
    Isoform 4 (identifier: Q60636-4) [UniParc]FASTAAdd to Basket

    Also known as: 1C

    The sequence of this isoform differs from the canonical sequence as follows:
         1-47: MREAYLRCWI...TALDSYSTVQ → MTPGVPGHRTQQRPQHISALSDKAKDCSK

    Note: Produced by alternative promoter usage of isoform 2.

    Show »
    Length:838
    Mass (Da):93,302
    Checksum:iEF258AECEFFB6B1A
    GO
    Isoform 5 (identifier: Q60636-5) [UniParc]FASTAAdd to Basket

    Also known as: delta exon 7

    The sequence of this isoform differs from the canonical sequence as follows:
         624-666: Missing.

    Note: Produced by alternative splicing of isoform 1. Does not bind DNA.

    Show »
    Length:813
    Mass (Da):90,830
    Checksum:iDDC40E049A8BE135
    GO

    Sequence cautioni

    The sequence AAI29802.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti155 – 1551N → K in AAI29802. (PubMed:15489334)Curated
    Sequence conflicti205 – 2051L → M in AK077622. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6767Missing in isoform 3. 1 PublicationVSP_041570Add
    BLAST
    Alternative sequencei1 – 4747MREAY…YSTVQ → MLDLLLEKRVGTTL in isoform 2. 2 PublicationsVSP_039189Add
    BLAST
    Alternative sequencei1 – 4747MREAY…YSTVQ → MTPGVPGHRTQQRPQHISAL SDKAKDCSK in isoform 4. CuratedVSP_041571Add
    BLAST
    Alternative sequencei624 – 66643Missing in isoform 5. CuratedVSP_041572Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U08185 mRNA. Translation: AAA19252.1.
    AF305539
    , AF305534, AF305535, AF305536, AF305537, AF305538 Genomic DNA. Translation: AAG42212.1.
    AK077622 mRNA. No translation available.
    AK149344 mRNA. Translation: BAE28822.1.
    BC129801 mRNA. Translation: AAI29802.1. Different initiation.
    CCDSiCCDS23825.2. [Q60636-2]
    PIRiA53503.
    RefSeqiNP_031574.2. NM_007548.3. [Q60636-2]
    XP_006512565.1. XM_006512502.1. [Q60636-4]
    XP_006512566.1. XM_006512503.1. [Q60636-3]
    XP_006512568.1. XM_006512505.1. [Q60636-1]
    UniGeneiMm.4800.

    Genome annotation databases

    EnsembliENSMUST00000039174; ENSMUSP00000039248; ENSMUSG00000038151. [Q60636-1]
    ENSMUST00000105490; ENSMUSP00000101129; ENSMUSG00000038151. [Q60636-2]
    GeneIDi12142.
    KEGGimmu:12142.
    UCSCiuc007ezu.2. mouse. [Q60636-1]
    uc007ezv.2. mouse. [Q60636-2]

    Keywords - Coding sequence diversityi

    Alternative promoter usage, Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U08185 mRNA. Translation: AAA19252.1 .
    AF305539
    , AF305534 , AF305535 , AF305536 , AF305537 , AF305538 Genomic DNA. Translation: AAG42212.1 .
    AK077622 mRNA. No translation available.
    AK149344 mRNA. Translation: BAE28822.1 .
    BC129801 mRNA. Translation: AAI29802.1 . Different initiation.
    CCDSi CCDS23825.2. [Q60636-2 ]
    PIRi A53503.
    RefSeqi NP_031574.2. NM_007548.3. [Q60636-2 ]
    XP_006512565.1. XM_006512502.1. [Q60636-4 ]
    XP_006512566.1. XM_006512503.1. [Q60636-3 ]
    XP_006512568.1. XM_006512505.1. [Q60636-1 ]
    UniGenei Mm.4800.

    3D structure databases

    ProteinModelPortali Q60636.
    SMRi Q60636. Positions 75-289, 556-768.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 198355. 3 interactions.
    IntActi Q60636. 1 interaction.
    STRINGi 10090.ENSMUSP00000101129.

    PTM databases

    PhosphoSitei Q60636.

    Proteomic databases

    PaxDbi Q60636.
    PRIDEi Q60636.

    Protocols and materials databases

    DNASUi 12142.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000039174 ; ENSMUSP00000039248 ; ENSMUSG00000038151 . [Q60636-1 ]
    ENSMUST00000105490 ; ENSMUSP00000101129 ; ENSMUSG00000038151 . [Q60636-2 ]
    GeneIDi 12142.
    KEGGi mmu:12142.
    UCSCi uc007ezu.2. mouse. [Q60636-1 ]
    uc007ezv.2. mouse. [Q60636-2 ]

    Organism-specific databases

    CTDi 639.
    MGIi MGI:99655. Prdm1.

    Phylogenomic databases

    eggNOGi COG5048.
    GeneTreei ENSGT00740000115517.
    HOGENOMi HOG000059670.
    HOVERGENi HBG053670.
    InParanoidi Q3UET9.
    OMAi TGYKTLP.
    OrthoDBi EOG7060Q3.
    PhylomeDBi Q60636.
    TreeFami TF316545.

    Miscellaneous databases

    NextBioi 280465.
    PROi Q60636.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q60636.
    CleanExi MM_PRDM1.
    Genevestigatori Q60636.

    Family and domain databases

    Gene3Di 3.30.160.60. 5 hits.
    InterProi IPR001214. SET_dom.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    IPR016608. Znf_PRDM1.
    [Graphical view ]
    Pfami PF00856. SET. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF013212. PRDM1. 1 hit.
    SMARTi SM00317. SET. 1 hit.
    SM00355. ZnF_C2H2. 5 hits.
    [Graphical view ]
    PROSITEi PS50280. SET. 1 hit.
    PS00028. ZINC_FINGER_C2H2_1. 4 hits.
    PS50157. ZINC_FINGER_C2H2_2. 4 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Blimp-1, a novel zinc finger-containing protein that can drive the maturation of B lymphocytes into immunoglobulin-secreting cells."
      Turner C.A., Mack D.H., Davis M.M.
      Cell 77:297-306(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
      Strain: BALB/c.
      Tissue: B-cell.
    2. "Characterization of the B lymphocyte-induced maturation protein-1 (Blimp-1) gene, mRNA isoforms and basal promoter."
      Tunyaplin C., Shapiro M.A., Calame K.L.
      Nucleic Acids Res. 28:4846-4855(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS 1 AND 5), TISSUE SPECIFICITY.
      Strain: 129.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [MRNA] OF 1-253 (ISOFORM 3).
      Strain: C57BL/6J.
      Tissue: Embryo and Retina.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    5. "Blimp1 associates with Prmt5 and directs histone arginine methylation in mouse germ cells."
      Ancelin K., Lange U.C., Hajkova P., Schneider R., Bannister A.J., Kouzarides T., Surani M.A.
      Nat. Cell Biol. 8:623-630(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH PRMT5.
    6. "Blimp-1/Prdm1 alternative promoter usage during mouse development and plasma cell differentiation."
      Morgan M.A., Magnusdottir E., Kuo T.C., Tunyaplin C., Harper J., Arnold S.J., Calame K., Robertson E.J., Bikoff E.K.
      Mol. Cell. Biol. 29:5813-5827(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE PROMOTER USAGE (ISOFORMS 3 AND 4), ALTERNATIVE SPLICING (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, DISRUPTION PHENOTYPE.
      Tissue: Embryo, Placenta and Yolk sac.

    Entry informationi

    Entry nameiPRDM1_MOUSE
    AccessioniPrimary (citable) accession number: Q60636
    Secondary accession number(s): A2VDE8, Q3UET9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 8, 2002
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 126 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3