Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-like protein KIF1B

Gene

Kif1b

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Motor for anterograde transport of mitochondria. Has a microtubule plus end-directed motility.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi97 – 1048ATPPROSITE-ProRule annotation

GO - Molecular functioni

  • ATPase activity Source: UniProtKB
  • ATP binding Source: UniProtKB-KW
  • microtubule binding Source: UniProtKB
  • microtubule motor activity Source: UniProtKB

GO - Biological processi

  • anterograde axonal transport Source: UniProtKB
  • cytoskeleton-dependent intracellular transport Source: UniProtKB
  • embryo development Source: UniProtKB
  • microtubule-based movement Source: UniProtKB
  • mitochondrion transport along microtubule Source: MGI
  • neuromuscular synaptic transmission Source: UniProtKB
  • neuron-neuron synaptic transmission Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Motor protein

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein KIF1B
Gene namesi
Name:Kif1b
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:108426. Kif1b.

Subcellular locationi

GO - Cellular componenti

  • axon Source: GOC
  • cytoplasmic vesicle Source: UniProtKB
  • cytoplasmic vesicle membrane Source: UniProtKB
  • microtubule Source: UniProtKB-KW
  • microtubule associated complex Source: UniProtKB
  • mitochondrion Source: MGI
  • neuron projection Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Microtubule, Mitochondrion

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemovedBy similarity
Chaini2 – 18161815Kinesin-like protein KIF1BPRO_0000125408Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylserineBy similarity
Modified residuei647 – 6471PhosphothreonineCombined sources
Modified residuei652 – 6521PhosphothreonineCombined sources
Modified residuei1057 – 10571PhosphoserineBy similarity
Modified residuei1454 – 14541PhosphoserineCombined sources
Modified residuei1487 – 14871PhosphoserineCombined sources
Modified residuei1573 – 15731PhosphoserineBy similarity
Modified residuei1603 – 16031PhosphoserineBy similarity
Modified residuei1610 – 16101PhosphoserineBy similarity
Modified residuei1613 – 16131PhosphoserineBy similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ60575.
MaxQBiQ60575.
PaxDbiQ60575.
PRIDEiQ60575.

PTM databases

iPTMnetiQ60575.
PhosphoSiteiQ60575.

Expressioni

Tissue specificityi

Expressed almost exclusively in adult brain tissue (mainly in the cerebellum and cerebrum) within a single type of neuronal cell.

Gene expression databases

BgeeiQ60575.
CleanExiMM_KIF1B.
ExpressionAtlasiQ60575. baseline and differential.
GenevisibleiQ60575. MM.

Interactioni

Subunit structurei

Monomer. Interacts with KBP. Interacts (via C-terminus end of the kinesin-motor domain) with CHP1; the interaction occurs in a calcium-dependent manner (By similarity).By similarity

GO - Molecular functioni

  • microtubule binding Source: UniProtKB

Protein-protein interaction databases

BioGridi200936. 8 interactions.
IntActiQ60575. 6 interactions.
STRINGi10090.ENSMUSP00000061472.

Structurei

3D structure databases

ProteinModelPortaliQ60575.
SMRiQ60575. Positions 4-353, 471-647.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini5 – 354350Kinesin motorPROSITE-ProRule annotationAdd
BLAST
Domaini556 – 61257FHAPROSITE-ProRule annotationAdd
BLAST
Domaini1702 – 179998PHPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni270 – 35081Interaction with KBPBy similarityAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili365 – 38622Sequence analysisAdd
BLAST
Coiled coili470 – 50233Sequence analysisAdd
BLAST
Coiled coili668 – 73770Sequence analysisAdd
BLAST
Coiled coili841 – 86929Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. Unc-104 subfamily.PROSITE-ProRule annotation
Contains 1 FHA domain.PROSITE-ProRule annotation
Contains 1 kinesin motor domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0245. Eukaryota.
COG5059. LUCA.
GeneTreeiENSGT00840000129680.
HOGENOMiHOG000165968.
HOVERGENiHBG052251.
InParanoidiQ60575.
KOiK10392.
OMAiGQSMSKY.
OrthoDBiEOG77Q4VS.
PhylomeDBiQ60575.
TreeFamiTF105221.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
2.60.200.20. 1 hit.
3.40.850.10. 1 hit.
InterProiIPR000253. FHA_dom.
IPR022164. Kinesin-like.
IPR027640. Kinesin-like_fam.
IPR022140. Kinesin-like_KIF1-typ.
IPR032405. Kinesin_assoc.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008984. SMAD_FHA_domain.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 3 hits.
PfamiPF12473. DUF3694. 1 hit.
PF00498. FHA. 1 hit.
PF12423. KIF1B. 1 hit.
PF00225. Kinesin. 1 hit.
PF16183. Kinesin_assoc. 1 hit.
PF00169. PH. 1 hit.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00240. FHA. 1 hit.
SM00129. KISc. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF49879. SSF49879. 1 hit.
SSF50729. SSF50729. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50006. FHA_DOMAIN. 1 hit.
PS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q60575-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSGASVKVAV RVRPFNSRET SKESKCIIQM QGNSTSIINP KNPKEAPKSF
60 70 80 90 100
SFDYSYWSHT SPEDPCFASQ NRVYNDIGKE MLLHAFEGYN VCIFAYGQTG
110 120 130 140 150
AGKSYTMMGK QEESQAGIIP QLCEELFEKI NDNCNEEMSY SVEVSYMEIY
160 170 180 190 200
CERVRDLLNP KNKGNLRVRE HPLLGPYVED LSKLAVTSYT DIADLMDAGN
210 220 230 240 250
KARTVAATNM NETSSRSHAV FTIVFTQKKQ DPETNLSTEK VSKISLVDLA
260 270 280 290 300
GSERADSTGA KGTRLKEGAN INKSLTTLGK VISALAEVDN CTSKSKKKKK
310 320 330 340 350
TDFIPYRDSV LTWLLRENLG GNSRTAMVAA LSPADINYDE TLSTLRYADR
360 370 380 390 400
AKQIKCNAVI NEDPNAKLVR ELKEEVTRLK DLLRAQGLGD IIDIDPLIDD
410 420 430 440 450
YSGSGGKYLK DFQNNKHRYL LASENQRPGN FSTASMGSLT SSPSSCSLNS
460 470 480 490 500
QVGLTSVTSI QERIMSTPGG EEAIERLKES EKIIAELNET WEEKLRKTEA
510 520 530 540 550
IRMEREALLA EMGVAIREDG GTLGVFSPKK TPHLVNLNED PLMSECLLYY
560 570 580 590 600
IKDGITRVGQ ADAERRQDIV LSGAHIKEEH CLFRSERSNT GEVIVTLEPC
610 620 630 640 650
ERSETYVNGK RVAHPVQLRS GNRIIMGKNH VFRFNHPEQA RAEREKTPSA
660 670 680 690 700
ETPSEPVDWT FAQRELLEKQ GIDMKQEMEK RLQEMEILYK KEKEEADLLL
710 720 730 740 750
EQQRLDYESK LQALQRQVET RSLAAETTEE EEEEEEVPWT QHEFELAQWA
760 770 780 790 800
FRKWKSHQFT SLRDLLWGNA VYLKEANAIS VELKKKVQFQ FVLLTDTLYS
810 820 830 840 850
PVPPELLPSE MEKTHEDRPF PRTVVAVEVQ DLKNGATHYW SLDKLKQRLD
860 870 880 890 900
LMREMYDRAG EVASSAQDDS ETTMTGSDPF YDRFHWFKLV GSSPIFHGCV
910 920 930 940 950
NERLADRTPS PTFSTADSDI TELADEQQDA MEDFDDEAFV DDTGSDAGTE
960 970 980 990 1000
EGSELFSDGH DPFYDRSPWF ILVGRAFVYL SNLLYPVPLI HRVAIVSEKG
1010 1020 1030 1040 1050
EVRGFLRVAV QAIAADEEAP DYGSGIRQSG TAKISFDNEY FNQSDFSSAA
1060 1070 1080 1090 1100
MTRSGLSLEE LRIVEGQGQS SEVISPPEEV NRMNDLDLKS GTLLDGKMVM
1110 1120 1130 1140 1150
EGFSEEIGNH LKLGSAFTFR VTVLQASGIL PEYADIFCQF NFLHRHDEAF
1160 1170 1180 1190 1200
STEPLKNNGR GSPLGFYHVQ NIAVEVTESF VDYIKTKPIV FEVFGHYQQH
1210 1220 1230 1240 1250
PLHLQGQDLN SPPQPSRRFF PPPMPLSKPV PATKLNTMNK TTLGQSMSKY
1260 1270 1280 1290 1300
DLLVWFEISE LEPTGEYIPA VVDHTAGLPC QGTFLLHQGI QRRITVTIIH
1310 1320 1330 1340 1350
EKGSELHWKD VRELVVGRIR NKPEVDEAAV DAVLSLNIIS AKSLKAAHSS
1360 1370 1380 1390 1400
SRTFYRFEAV WDSSLHNSLL LNRVTPYGEK IYMTLSAYLE LDHCIQPAVI
1410 1420 1430 1440 1450
TKDVCMVFYS RDAKISPPRS LRNLFGSGYS KSPDSNRVTG IYELSLCKMA
1460 1470 1480 1490 1500
DTGSPGMQRR RRKVLDTSVA YVRGEENLAG WRPRGDSLIL EHQWELEKLE
1510 1520 1530 1540 1550
LLHEVEKTRH FLLLRERLGD SVPKSLSDSL SPSLSSGTLS TSTSISSQIS
1560 1570 1580 1590 1600
TTTFESAITP SESSGYDSAD VESLVDREKE LATKCLQLLT HTFNREFSQV
1610 1620 1630 1640 1650
HGSISDCKLS DISPIGRDPS VSSFSSSTLT PSSTCPSLVD SRSSSMDQKT
1660 1670 1680 1690 1700
PEANSRASSP CQEFEQFQIV PTVETPYLAR AGKNEFLNLV PDIEEVRAGS
1710 1720 1730 1740 1750
VVSKKGYLHF KEPLSSNWAK HFVVVRRPYV FIYNSDKDPV ERGIINLSTA
1760 1770 1780 1790 1800
QVEYSEDQQA MVKTPNTFAV CTKHRGVLLQ ALNDKDMNDW LYAFNPLLAG
1810
TIRSKLSRRC PSQPKY
Length:1,816
Mass (Da):204,081
Last modified:January 11, 2001 - v2
Checksum:iE316EC295138E5DE
GO
Isoform 2 (identifier: Q60575-2) [UniParc]FASTAAdd to basket

Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     289-294: Missing.
     394-434: IDPLIDDYSGSGGKYLKDFQNNKHRYLLASENQRPGNFSTA → T

Show »
Length:1,770
Mass (Da):198,920
Checksum:i2F8B32554B155ABA
GO
Isoform 3 (identifier: Q60575-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     289-294: Missing.
     394-434: IDPLIDDYSGSGGKYLKDFQNNKHRYLLASENQRPGNFSTA → T
     707-1196: YESKLQALQR...KPIVFEVFGH → ADSDSGDDSD...NLKAGRETTV
     1197-1816: Missing.

Show »
Length:1,150
Mass (Da):130,123
Checksum:i5BD3E9667325EE86
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti117 – 1171G → V (PubMed:7528108).Curated
Sequence conflicti117 – 1171G → V (PubMed:10571041).Curated
Sequence conflicti520 – 5234GGTL → RGDI in BAA04503 (PubMed:7528108).Curated
Sequence conflicti909 – 9091P → S in BAA75243 (Ref. 4) Curated
Sequence conflicti1608 – 16092KL → TW in AAD39438 (PubMed:10341097).Curated
Sequence conflicti1612 – 16121I → V in AAD39438 (PubMed:10341097).Curated
Sequence conflicti1784 – 17841D → G in BAA75243 (Ref. 4) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei289 – 2946Missing in isoform 2 and isoform 3. 2 PublicationsVSP_002862
Alternative sequencei394 – 43441IDPLI…NFSTA → T in isoform 2 and isoform 3. 2 PublicationsVSP_002863Add
BLAST
Alternative sequencei707 – 1196490YESKL…EVFGH → ADSDSGDDSDKRSCEESWKL ITSLREKLPPSKLQTIVKKC GLPSSGKKREPIKMYQIPQR RRLSKDSKWVTISDLKIQAV KEICYEVALNDFRHSRQEIE ALAIVKMKELCAMYGKKDPN ERDSWRAVARDVWDTVGVGD EKIEDMMVTGKGGTDVDDLK VHIDKLEDILQEVKKQNNMK DEEIKVLRNKMLKMEKVLPL IGSQEQKSQGSHKTKEPLVA GANSVSDNGVSKGESGELGK EERVSQLMNGDPAFRRGRLR WMRQEQIRFKNLQQQEITKQ LRRQNVPHRFIPPENRKPRF PFKSNPKHRNSWSPGTHIII TEDEVIELRIPKDEEGRKEN KEESQEKVGRAASRDVQSAW GTRSQDHIQVSKQHISNQQP PPQLRWRSNSLNNGQPKTTR CQATASSESLNSHSGHPTAD LQTFQAKRHIHQHRQPYCNY NTGGQVEGSTASCCQKQTDK PSHCNQFVTPPRMRRQFSAP NLKAGRETTV in isoform 3. 1 PublicationVSP_002864Add
BLAST
Alternative sequencei1197 – 1816620Missing in isoform 3. 1 PublicationVSP_002865Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D17577 mRNA. Translation: BAA04503.1.
AF090190 mRNA. Translation: AAF06718.1.
AF131865 mRNA. Translation: AAD39438.1.
AB023656 mRNA. Translation: BAA75243.1.
CCDSiCCDS18956.1. [Q60575-2]
CCDS18957.1. [Q60575-3]
CCDS71521.1. [Q60575-1]
PIRiA55289.
RefSeqiNP_001277924.1. NM_001290995.1. [Q60575-1]
NP_032467.2. NM_008441.2.
UniGeneiMm.402393.
Mm.474289.

Genome annotation databases

EnsembliENSMUST00000055647; ENSMUSP00000061472; ENSMUSG00000063077. [Q60575-2]
ENSMUST00000060537; ENSMUSP00000056754; ENSMUSG00000063077. [Q60575-1]
GeneIDi16561.
KEGGimmu:16561.
UCSCiuc008vvy.2. mouse. [Q60575-2]
uc008vvz.2. mouse. [Q60575-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D17577 mRNA. Translation: BAA04503.1.
AF090190 mRNA. Translation: AAF06718.1.
AF131865 mRNA. Translation: AAD39438.1.
AB023656 mRNA. Translation: BAA75243.1.
CCDSiCCDS18956.1. [Q60575-2]
CCDS18957.1. [Q60575-3]
CCDS71521.1. [Q60575-1]
PIRiA55289.
RefSeqiNP_001277924.1. NM_001290995.1. [Q60575-1]
NP_032467.2. NM_008441.2.
UniGeneiMm.402393.
Mm.474289.

3D structure databases

ProteinModelPortaliQ60575.
SMRiQ60575. Positions 4-353, 471-647.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi200936. 8 interactions.
IntActiQ60575. 6 interactions.
STRINGi10090.ENSMUSP00000061472.

PTM databases

iPTMnetiQ60575.
PhosphoSiteiQ60575.

Proteomic databases

EPDiQ60575.
MaxQBiQ60575.
PaxDbiQ60575.
PRIDEiQ60575.

Protocols and materials databases

DNASUi16561.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000055647; ENSMUSP00000061472; ENSMUSG00000063077. [Q60575-2]
ENSMUST00000060537; ENSMUSP00000056754; ENSMUSG00000063077. [Q60575-1]
GeneIDi16561.
KEGGimmu:16561.
UCSCiuc008vvy.2. mouse. [Q60575-2]
uc008vvz.2. mouse. [Q60575-1]

Organism-specific databases

CTDi23095.
MGIiMGI:108426. Kif1b.

Phylogenomic databases

eggNOGiKOG0245. Eukaryota.
COG5059. LUCA.
GeneTreeiENSGT00840000129680.
HOGENOMiHOG000165968.
HOVERGENiHBG052251.
InParanoidiQ60575.
KOiK10392.
OMAiGQSMSKY.
OrthoDBiEOG77Q4VS.
PhylomeDBiQ60575.
TreeFamiTF105221.

Miscellaneous databases

ChiTaRSiKif1b. mouse.
NextBioi290051.
PROiQ60575.
SOURCEiSearch...

Gene expression databases

BgeeiQ60575.
CleanExiMM_KIF1B.
ExpressionAtlasiQ60575. baseline and differential.
GenevisibleiQ60575. MM.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
2.60.200.20. 1 hit.
3.40.850.10. 1 hit.
InterProiIPR000253. FHA_dom.
IPR022164. Kinesin-like.
IPR027640. Kinesin-like_fam.
IPR022140. Kinesin-like_KIF1-typ.
IPR032405. Kinesin_assoc.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008984. SMAD_FHA_domain.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 3 hits.
PfamiPF12473. DUF3694. 1 hit.
PF00498. FHA. 1 hit.
PF12423. KIF1B. 1 hit.
PF00225. Kinesin. 1 hit.
PF16183. Kinesin_assoc. 1 hit.
PF00169. PH. 1 hit.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00240. FHA. 1 hit.
SM00129. KISc. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF49879. SSF49879. 1 hit.
SSF50729. SSF50729. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50006. FHA_DOMAIN. 1 hit.
PS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "KIF1B, a novel microtubule plus end-directed monomeric motor protein for transport of mitochondria."
    Nangaku M., Sato-Yoshitake R., Okada Y., Noda Y., Takemura R., Yamazaki H., Hirokawa N.
    Cell 79:1209-1220(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    Tissue: Brain.
  2. "A novel kinesin of the UNC-104/KIF1 subfamily encoded by the Kif1b gene."
    Gong T.L., Winnicki R.S., Kohrman D.C., Lomax M.I.
    Gene 239:117-127(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: ICR.
    Tissue: Brain.
  3. "The major brain isoform of kif1b lacks the putative mitochondria-binding domain."
    Conforti L., Buckmaster E.A., Tarlton A., Brown M.C., Lyon M.F., Perry V.H., Coleman M.P.
    Mamm. Genome 10:617-622(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Brain.
  4. "Identification and characterization of a new kinesin superfamily KIF1B-beta."
    Nakagawa T., Hirokawa N.
    Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Strain: ICR.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1487, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  6. "Specific phosphopeptide enrichment with immobilized titanium ion affinity chromatography adsorbent for phosphoproteome analysis."
    Zhou H., Ye M., Dong J., Han G., Jiang X., Wu R., Zou H.
    J. Proteome Res. 7:3957-3967(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1454, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-647; THR-652; SER-1454 AND SER-1487, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Heart, Kidney, Liver, Lung, Pancreas, Spleen and Testis.

Entry informationi

Entry nameiKIF1B_MOUSE
AccessioniPrimary (citable) accession number: Q60575
Secondary accession number(s): Q9R0B4, Q9WVE5, Q9Z119
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 11, 2001
Last modified: May 11, 2016
This is version 139 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.