Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

F-box/WD repeat-containing protein 10

Gene

FBXW10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Probable substrate-recognition component of a SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Overexpression is leading to degradation of CBX5 and CBX1.1 Publication

Keywords - Biological processi

Ubl conjugation pathway

Enzyme and pathway databases

ReactomeiR-HSA-390471. Association of TriC/CCT with target proteins during biosynthesis.
SignaLinkiQ5XX13.

Names & Taxonomyi

Protein namesi
Recommended name:
F-box/WD repeat-containing protein 10
Alternative name(s):
F-box and WD-40 domain-containing protein 10
Ubiquitin ligase-specificity factor
Gene namesi
Name:FBXW10
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:1211. FBXW10.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25575.

Polymorphism and mutation databases

BioMutaiFBXW10.
DMDMi296434504.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10521052F-box/WD repeat-containing protein 10PRO_0000315834Add
BLAST

Proteomic databases

EPDiQ5XX13.
PaxDbiQ5XX13.
PeptideAtlasiQ5XX13.
PRIDEiQ5XX13.

PTM databases

iPTMnetiQ5XX13.
PhosphoSiteiQ5XX13.

Expressioni

Inductioni

By disease-causing laminin A mutants also inducing CBX5 and CBX1 proteasomal degradation.1 Publication

Gene expression databases

BgeeiQ5XX13.
CleanExiHS_FBXW10.
ExpressionAtlasiQ5XX13. baseline and differential.
GenevisibleiQ5XX13. HS.

Organism-specific databases

HPAiHPA022836.
HPA047457.
HPA052491.

Interactioni

Protein-protein interaction databases

BioGridi115772. 2 interactions.
IntActiQ5XX13. 1 interaction.
STRINGi9606.ENSP00000379026.

Structurei

3D structure databases

ProteinModelPortaliQ5XX13.
SMRiQ5XX13. Positions 360-706.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati169 – 20638WD 1Add
BLAST
Domaini276 – 32348F-boxAdd
BLAST
Repeati409 – 44739WD 2Add
BLAST
Repeati451 – 49040WD 3Add
BLAST
Repeati493 – 53240WD 4Add
BLAST
Repeati534 – 56936WD 5Add
BLAST
Repeati572 – 60938WD 6Add
BLAST
Repeati611 – 65242WD 7Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili690 – 71930Sequence analysisAdd
BLAST
Coiled coili986 – 101025Sequence analysisAdd
BLAST

Sequence similaritiesi

Contains 1 F-box domain.Curated
Contains 7 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiENOG410IQCZ. Eukaryota.
ENOG410Z8UQ. LUCA.
GeneTreeiENSGT00760000119106.
HOGENOMiHOG000082454.
HOVERGENiHBG058028.
InParanoidiQ5XX13.
KOiK10266.
OMAiSSARGCN.
OrthoDBiEOG7KDFCB.
PhylomeDBiQ5XX13.
TreeFamiTF329175.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR001810. F-box_dom.
IPR020472. G-protein_beta_WD-40_rep.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 3 hits.
[Graphical view]
PRINTSiPR00320. GPROTEINBRPT.
SMARTiSM00320. WD40. 5 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
SSF81383. SSF81383. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5XX13-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MENLESRLKN APYFRCEKGT DSIPLCRKCE TCVLAWKIFS TKEWFCRIND
60 70 80 90 100
ISQRRFLVGI LKQLNSLYLL HYFQNILQTT QGKDFIYNRS RINLSKKEGK
110 120 130 140 150
VVKSSLNQML DKTVEQKMKE ILYWFANSTQ WTKANYTLLL LQMCNPKLLL
160 170 180 190 200
TAANVIRVLF LREENNISGL NQDITDVCFS PEKDHSSKSA TSQVYWTAKT
210 220 230 240 250
QHTSLPLSKA PENEHLLGAA SNPEEPWRNS LRCISEMNRL FSGKGDITKP
260 270 280 290 300
GYDPCNLLVD LDDIRDLSSG FSKYRDFIRY LPIHLSKYIL RMLDRHTLNK
310 320 330 340 350
CASVSQHWAA MAQQVKMDLS AHGFIQNQIT FLQGSYTRGI DPNYANKVSI
360 370 380 390 400
PVPKMVDDGK SMRVKHPKWK LRTKNEYNLW TAYQNEETQQ VLIEERNVFC
410 420 430 440 450
GTYNVRILSD TWDQNRVIHY SGGDLIAVSS NRKIHLLDII QVKAIPVEFR
460 470 480 490 500
GHAGSVRALF LCEEENFLLS GSYDLSIRYW DLKSGVCTRI FGGHQGTITC
510 520 530 540 550
MDLCKNRLVS GGRDCQVKVW DVDTGKCLKT FRHKDPILAT RINDTYIVSS
560 570 580 590 600
CERGLVKVWH IAMAQLVKTL SGHEGAVKCL FFDQWHLLSG STDGLVMAWS
610 620 630 640 650
MVGKYERCLM AFKHPKEVLD VSLLFLRVIS ACADGKIRIY NFLNGNCMKV
660 670 680 690 700
LKANGRGDPV LSFFIQGNRM VVNTESNVLM FQFEHIKWQY AVEKTKQKKN
710 720 730 740 750
KEKEEEKEEN SLMEILSKCN IQVHSPRESV SSKQTVIQEL LPGKPPKSRV
760 770 780 790 800
LLKPAKFSSA VLIEELQSQG KSKSPRRDAD DVEKAQKQGQ LETPGKLPSH
810 820 830 840 850
PKKKSWKIPM SPDQFLLTVS ALQHAHNSGE FAYPCRPQTE ITDVWGPSIS
860 870 880 890 900
YPRKVLNFKG KSIQRAVDRL RLSNPPIDVK RTSIPLEIQK LQPNLKISLH
910 920 930 940 950
SPRVQSTIPQ PMIIRSRFSG SLKGGDQVTS SIERAVCSTG PLTSMQVIKP
960 970 980 990 1000
NRMLAPQVGT ATLSLKKERP RIYTALDPFR VNTEFVLLTV KEEKEHQEAK
1010 1020 1030 1040 1050
MKEYQAREST GVVDPGKVSK AAWIRKIKGL PIDNFTKQGK TAAPELGQNV

FI
Length:1,052
Mass (Da):119,846
Last modified:May 18, 2010 - v2
Checksum:iC5FDFC2824E918F4
GO
Isoform 2 (identifier: Q5XX13-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     291-291: R → SMLGCMRGFPRHLPSWPSSGVSGSIFFFPG
     760-779: Missing.

Note: No experimental confirmation available.
Show »
Length:1,061
Mass (Da):120,720
Checksum:i952C029EEA85FAB9
GO
Isoform 3 (identifier: Q5XX13-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     617-669: Missing.

Note: No experimental confirmation available.
Show »
Length:999
Mass (Da):113,977
Checksum:i9EA51441C68F5BBB
GO
Isoform 4 (identifier: Q5XX13-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     779-779: Missing.

Note: No experimental confirmation available.
Show »
Length:1,051
Mass (Da):119,774
Checksum:i5281279CDC932BC9
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti236 – 2361E → K in CAB66756 (PubMed:11230166).Curated
Sequence conflicti275 – 2751R → L in AAU43731 (PubMed:15520277).Curated
Sequence conflicti275 – 2751R → L in AAH28364 (PubMed:15489334).Curated
Sequence conflicti413 – 4131D → V in CAB66756 (PubMed:11230166).Curated
Sequence conflicti638 – 6381R → L in AAU43731 (PubMed:15520277).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti23 – 231I → N.1 Publication
Corresponds to variant rs11544711 [ dbSNP | Ensembl ].
VAR_038341
Natural varianti372 – 3721R → G.
Corresponds to variant rs7209610 [ dbSNP | Ensembl ].
VAR_057600
Natural varianti821 – 8211A → T.1 Publication
Corresponds to variant rs1026259 [ dbSNP | Ensembl ].
VAR_038342

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei291 – 2911R → SMLGCMRGFPRHLPSWPSSG VSGSIFFFPG in isoform 2. 1 PublicationVSP_030727
Alternative sequencei617 – 66953Missing in isoform 3. 1 PublicationVSP_030728Add
BLAST
Alternative sequencei760 – 77920Missing in isoform 2. 1 PublicationVSP_030729Add
BLAST
Alternative sequencei779 – 7791Missing in isoform 4. 1 PublicationVSP_039178

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY729024 mRNA. Translation: AAU43731.1.
AL136822 mRNA. Translation: CAB66756.1.
AC107982 Genomic DNA. No translation available.
BC028364 mRNA. Translation: AAH28364.1.
BI828401 mRNA. No translation available.
CCDSiCCDS11199.3. [Q5XX13-1]
CCDS58524.1. [Q5XX13-3]
RefSeqiNP_001254514.1. NM_001267585.1. [Q5XX13-1]
NP_001254515.1. NM_001267586.1. [Q5XX13-3]
XP_006721483.1. XM_006721420.2. [Q5XX13-2]
UniGeneiHs.592128.

Genome annotation databases

EnsembliENST00000301938; ENSP00000306937; ENSG00000171931. [Q5XX13-3]
ENST00000308799; ENSP00000310382; ENSG00000171931. [Q5XX13-2]
ENST00000395665; ENSP00000379025; ENSG00000171931. [Q5XX13-1]
GeneIDi10517.
KEGGihsa:10517.
UCSCiuc002guk.4. human. [Q5XX13-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY729024 mRNA. Translation: AAU43731.1.
AL136822 mRNA. Translation: CAB66756.1.
AC107982 Genomic DNA. No translation available.
BC028364 mRNA. Translation: AAH28364.1.
BI828401 mRNA. No translation available.
CCDSiCCDS11199.3. [Q5XX13-1]
CCDS58524.1. [Q5XX13-3]
RefSeqiNP_001254514.1. NM_001267585.1. [Q5XX13-1]
NP_001254515.1. NM_001267586.1. [Q5XX13-3]
XP_006721483.1. XM_006721420.2. [Q5XX13-2]
UniGeneiHs.592128.

3D structure databases

ProteinModelPortaliQ5XX13.
SMRiQ5XX13. Positions 360-706.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115772. 2 interactions.
IntActiQ5XX13. 1 interaction.
STRINGi9606.ENSP00000379026.

PTM databases

iPTMnetiQ5XX13.
PhosphoSiteiQ5XX13.

Polymorphism and mutation databases

BioMutaiFBXW10.
DMDMi296434504.

Proteomic databases

EPDiQ5XX13.
PaxDbiQ5XX13.
PeptideAtlasiQ5XX13.
PRIDEiQ5XX13.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000301938; ENSP00000306937; ENSG00000171931. [Q5XX13-3]
ENST00000308799; ENSP00000310382; ENSG00000171931. [Q5XX13-2]
ENST00000395665; ENSP00000379025; ENSG00000171931. [Q5XX13-1]
GeneIDi10517.
KEGGihsa:10517.
UCSCiuc002guk.4. human. [Q5XX13-1]

Organism-specific databases

CTDi10517.
GeneCardsiFBXW10.
H-InvDBHIX0013610.
HGNCiHGNC:1211. FBXW10.
HPAiHPA022836.
HPA047457.
HPA052491.
MIMi611679. gene.
neXtProtiNX_Q5XX13.
PharmGKBiPA25575.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IQCZ. Eukaryota.
ENOG410Z8UQ. LUCA.
GeneTreeiENSGT00760000119106.
HOGENOMiHOG000082454.
HOVERGENiHBG058028.
InParanoidiQ5XX13.
KOiK10266.
OMAiSSARGCN.
OrthoDBiEOG7KDFCB.
PhylomeDBiQ5XX13.
TreeFamiTF329175.

Enzyme and pathway databases

ReactomeiR-HSA-390471. Association of TriC/CCT with target proteins during biosynthesis.
SignaLinkiQ5XX13.

Miscellaneous databases

GeneWikiiFBXW10.
GenomeRNAii10517.
PROiQ5XX13.
SOURCEiSearch...

Gene expression databases

BgeeiQ5XX13.
CleanExiHS_FBXW10.
ExpressionAtlasiQ5XX13. baseline and differential.
GenevisibleiQ5XX13. HS.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR001810. F-box_dom.
IPR020472. G-protein_beta_WD-40_rep.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 3 hits.
[Graphical view]
PRINTSiPR00320. GPROTEINBRPT.
SMARTiSM00320. WD40. 5 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
SSF81383. SSF81383. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Systematic analysis and nomenclature of mammalian F-box proteins."
    Jin J., Cardozo T., Lovering R.C., Elledge S.J., Pagano M., Harper J.W.
    Genes Dev. 18:2573-2580(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANTS ASN-23 AND THR-821.
    Tissue: Testis.
  3. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 630-837 (ISOFORM 4).
    Tissue: Testis.
  5. "Lamin A rod domain mutants target heterochromatin protein 1alpha and beta for proteasomal degradation by activation of F-box protein, FBXW10."
    Chaturvedi P., Parnaik V.K.
    PLoS ONE 5:E10620-E10620(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INDUCTION.

Entry informationi

Entry nameiFBW10_HUMAN
AccessioniPrimary (citable) accession number: Q5XX13
Secondary accession number(s): C9JRY8
, C9JZD7, Q8TC00, Q9H0F0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: May 18, 2010
Last modified: July 6, 2016
This is version 102 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.