Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

F-box/WD repeat-containing protein 10

Gene

FBXW10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Probable substrate-recognition component of a SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Overexpression is leading to degradation of CBX5 and CBX1.1 Publication

Keywords - Biological processi

Ubl conjugation pathway

Enzyme and pathway databases

ReactomeiR-HSA-390471. Association of TriC/CCT with target proteins during biosynthesis.
R-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.
SignaLinkiQ5XX13.

Names & Taxonomyi

Protein namesi
Recommended name:
F-box/WD repeat-containing protein 10
Alternative name(s):
F-box and WD-40 domain-containing protein 10
Ubiquitin ligase-specificity factor
Gene namesi
Name:FBXW10
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:1211. FBXW10.

Pathology & Biotechi

Organism-specific databases

DisGeNETi10517.
OpenTargetsiENSG00000171931.
PharmGKBiPA25575.

Polymorphism and mutation databases

BioMutaiFBXW10.
DMDMi296434504.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003158341 – 1052F-box/WD repeat-containing protein 10Add BLAST1052

Proteomic databases

PaxDbiQ5XX13.
PeptideAtlasiQ5XX13.
PRIDEiQ5XX13.

PTM databases

iPTMnetiQ5XX13.
PhosphoSitePlusiQ5XX13.

Expressioni

Inductioni

By disease-causing laminin A mutants also inducing CBX5 and CBX1 proteasomal degradation.1 Publication

Gene expression databases

BgeeiENSG00000171931.
CleanExiHS_FBXW10.
ExpressionAtlasiQ5XX13. baseline and differential.
GenevisibleiQ5XX13. HS.

Organism-specific databases

HPAiHPA022836.
HPA047457.
HPA052491.

Interactioni

Protein-protein interaction databases

BioGridi115772. 2 interactors.
IntActiQ5XX13. 1 interactor.
STRINGi9606.ENSP00000379026.

Structurei

3D structure databases

ProteinModelPortaliQ5XX13.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati169 – 206WD 1Add BLAST38
Domaini276 – 323F-boxAdd BLAST48
Repeati409 – 447WD 2Add BLAST39
Repeati451 – 490WD 3Add BLAST40
Repeati493 – 532WD 4Add BLAST40
Repeati534 – 569WD 5Add BLAST36
Repeati572 – 609WD 6Add BLAST38
Repeati611 – 652WD 7Add BLAST42

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili690 – 719Sequence analysisAdd BLAST30
Coiled coili986 – 1010Sequence analysisAdd BLAST25

Sequence similaritiesi

Contains 1 F-box domain.Curated
Contains 7 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiENOG410IQCZ. Eukaryota.
ENOG410Z8UQ. LUCA.
GeneTreeiENSGT00760000119106.
HOGENOMiHOG000082454.
HOVERGENiHBG058028.
InParanoidiQ5XX13.
KOiK10266.
OMAiSSARGCN.
OrthoDBiEOG091G0OPK.
PhylomeDBiQ5XX13.
TreeFamiTF329175.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR001810. F-box_dom.
IPR020472. G-protein_beta_WD-40_rep.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 3 hits.
[Graphical view]
PRINTSiPR00320. GPROTEINBRPT.
SMARTiSM00320. WD40. 5 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
SSF81383. SSF81383. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5XX13-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MENLESRLKN APYFRCEKGT DSIPLCRKCE TCVLAWKIFS TKEWFCRIND
60 70 80 90 100
ISQRRFLVGI LKQLNSLYLL HYFQNILQTT QGKDFIYNRS RINLSKKEGK
110 120 130 140 150
VVKSSLNQML DKTVEQKMKE ILYWFANSTQ WTKANYTLLL LQMCNPKLLL
160 170 180 190 200
TAANVIRVLF LREENNISGL NQDITDVCFS PEKDHSSKSA TSQVYWTAKT
210 220 230 240 250
QHTSLPLSKA PENEHLLGAA SNPEEPWRNS LRCISEMNRL FSGKGDITKP
260 270 280 290 300
GYDPCNLLVD LDDIRDLSSG FSKYRDFIRY LPIHLSKYIL RMLDRHTLNK
310 320 330 340 350
CASVSQHWAA MAQQVKMDLS AHGFIQNQIT FLQGSYTRGI DPNYANKVSI
360 370 380 390 400
PVPKMVDDGK SMRVKHPKWK LRTKNEYNLW TAYQNEETQQ VLIEERNVFC
410 420 430 440 450
GTYNVRILSD TWDQNRVIHY SGGDLIAVSS NRKIHLLDII QVKAIPVEFR
460 470 480 490 500
GHAGSVRALF LCEEENFLLS GSYDLSIRYW DLKSGVCTRI FGGHQGTITC
510 520 530 540 550
MDLCKNRLVS GGRDCQVKVW DVDTGKCLKT FRHKDPILAT RINDTYIVSS
560 570 580 590 600
CERGLVKVWH IAMAQLVKTL SGHEGAVKCL FFDQWHLLSG STDGLVMAWS
610 620 630 640 650
MVGKYERCLM AFKHPKEVLD VSLLFLRVIS ACADGKIRIY NFLNGNCMKV
660 670 680 690 700
LKANGRGDPV LSFFIQGNRM VVNTESNVLM FQFEHIKWQY AVEKTKQKKN
710 720 730 740 750
KEKEEEKEEN SLMEILSKCN IQVHSPRESV SSKQTVIQEL LPGKPPKSRV
760 770 780 790 800
LLKPAKFSSA VLIEELQSQG KSKSPRRDAD DVEKAQKQGQ LETPGKLPSH
810 820 830 840 850
PKKKSWKIPM SPDQFLLTVS ALQHAHNSGE FAYPCRPQTE ITDVWGPSIS
860 870 880 890 900
YPRKVLNFKG KSIQRAVDRL RLSNPPIDVK RTSIPLEIQK LQPNLKISLH
910 920 930 940 950
SPRVQSTIPQ PMIIRSRFSG SLKGGDQVTS SIERAVCSTG PLTSMQVIKP
960 970 980 990 1000
NRMLAPQVGT ATLSLKKERP RIYTALDPFR VNTEFVLLTV KEEKEHQEAK
1010 1020 1030 1040 1050
MKEYQAREST GVVDPGKVSK AAWIRKIKGL PIDNFTKQGK TAAPELGQNV

FI
Length:1,052
Mass (Da):119,846
Last modified:May 18, 2010 - v2
Checksum:iC5FDFC2824E918F4
GO
Isoform 2 (identifier: Q5XX13-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     291-291: R → SMLGCMRGFPRHLPSWPSSGVSGSIFFFPG
     760-779: Missing.

Note: No experimental confirmation available.
Show »
Length:1,061
Mass (Da):120,720
Checksum:i952C029EEA85FAB9
GO
Isoform 3 (identifier: Q5XX13-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     617-669: Missing.

Note: No experimental confirmation available.
Show »
Length:999
Mass (Da):113,977
Checksum:i9EA51441C68F5BBB
GO
Isoform 4 (identifier: Q5XX13-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     779-779: Missing.

Note: No experimental confirmation available.
Show »
Length:1,051
Mass (Da):119,774
Checksum:i5281279CDC932BC9
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti236E → K in CAB66756 (PubMed:11230166).Curated1
Sequence conflicti275R → L in AAU43731 (PubMed:15520277).Curated1
Sequence conflicti275R → L in AAH28364 (PubMed:15489334).Curated1
Sequence conflicti413D → V in CAB66756 (PubMed:11230166).Curated1
Sequence conflicti638R → L in AAU43731 (PubMed:15520277).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03834123I → N.1 PublicationCorresponds to variant rs11544711dbSNPEnsembl.1
Natural variantiVAR_057600372R → G.Corresponds to variant rs7209610dbSNPEnsembl.1
Natural variantiVAR_038342821A → T.1 PublicationCorresponds to variant rs1026259dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_030727291R → SMLGCMRGFPRHLPSWPSSG VSGSIFFFPG in isoform 2. 1 Publication1
Alternative sequenceiVSP_030728617 – 669Missing in isoform 3. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_030729760 – 779Missing in isoform 2. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_039178779Missing in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY729024 mRNA. Translation: AAU43731.1.
AL136822 mRNA. Translation: CAB66756.1.
AC107982 Genomic DNA. No translation available.
BC028364 mRNA. Translation: AAH28364.1.
BI828401 mRNA. No translation available.
CCDSiCCDS11199.3. [Q5XX13-1]
CCDS58524.1. [Q5XX13-3]
RefSeqiNP_001254514.1. NM_001267585.1. [Q5XX13-1]
NP_001254515.1. NM_001267586.1. [Q5XX13-3]
UniGeneiHs.592128.

Genome annotation databases

EnsembliENST00000301938; ENSP00000306937; ENSG00000171931. [Q5XX13-3]
ENST00000308799; ENSP00000310382; ENSG00000171931. [Q5XX13-2]
ENST00000395665; ENSP00000379025; ENSG00000171931. [Q5XX13-1]
GeneIDi10517.
KEGGihsa:10517.
UCSCiuc002guk.4. human. [Q5XX13-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY729024 mRNA. Translation: AAU43731.1.
AL136822 mRNA. Translation: CAB66756.1.
AC107982 Genomic DNA. No translation available.
BC028364 mRNA. Translation: AAH28364.1.
BI828401 mRNA. No translation available.
CCDSiCCDS11199.3. [Q5XX13-1]
CCDS58524.1. [Q5XX13-3]
RefSeqiNP_001254514.1. NM_001267585.1. [Q5XX13-1]
NP_001254515.1. NM_001267586.1. [Q5XX13-3]
UniGeneiHs.592128.

3D structure databases

ProteinModelPortaliQ5XX13.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115772. 2 interactors.
IntActiQ5XX13. 1 interactor.
STRINGi9606.ENSP00000379026.

PTM databases

iPTMnetiQ5XX13.
PhosphoSitePlusiQ5XX13.

Polymorphism and mutation databases

BioMutaiFBXW10.
DMDMi296434504.

Proteomic databases

PaxDbiQ5XX13.
PeptideAtlasiQ5XX13.
PRIDEiQ5XX13.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000301938; ENSP00000306937; ENSG00000171931. [Q5XX13-3]
ENST00000308799; ENSP00000310382; ENSG00000171931. [Q5XX13-2]
ENST00000395665; ENSP00000379025; ENSG00000171931. [Q5XX13-1]
GeneIDi10517.
KEGGihsa:10517.
UCSCiuc002guk.4. human. [Q5XX13-1]

Organism-specific databases

CTDi10517.
DisGeNETi10517.
GeneCardsiFBXW10.
H-InvDBHIX0013610.
HGNCiHGNC:1211. FBXW10.
HPAiHPA022836.
HPA047457.
HPA052491.
MIMi611679. gene.
neXtProtiNX_Q5XX13.
OpenTargetsiENSG00000171931.
PharmGKBiPA25575.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IQCZ. Eukaryota.
ENOG410Z8UQ. LUCA.
GeneTreeiENSGT00760000119106.
HOGENOMiHOG000082454.
HOVERGENiHBG058028.
InParanoidiQ5XX13.
KOiK10266.
OMAiSSARGCN.
OrthoDBiEOG091G0OPK.
PhylomeDBiQ5XX13.
TreeFamiTF329175.

Enzyme and pathway databases

ReactomeiR-HSA-390471. Association of TriC/CCT with target proteins during biosynthesis.
R-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.
SignaLinkiQ5XX13.

Miscellaneous databases

GeneWikiiFBXW10.
GenomeRNAii10517.
PROiQ5XX13.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000171931.
CleanExiHS_FBXW10.
ExpressionAtlasiQ5XX13. baseline and differential.
GenevisibleiQ5XX13. HS.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR001810. F-box_dom.
IPR020472. G-protein_beta_WD-40_rep.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 3 hits.
[Graphical view]
PRINTSiPR00320. GPROTEINBRPT.
SMARTiSM00320. WD40. 5 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
SSF81383. SSF81383. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFBW10_HUMAN
AccessioniPrimary (citable) accession number: Q5XX13
Secondary accession number(s): C9JRY8
, C9JZD7, Q8TC00, Q9H0F0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: May 18, 2010
Last modified: November 2, 2016
This is version 105 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.