Reviewed,
UniProtKB/Swiss-Prot Q5XPT3 (LARG2_MOUSE)
Last modified
October 13, 2009.
Version 41.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Glycosyltransferase-like protein LARGE2 EC=2.4.-.- Alternative name(s): Glycosyltransferase-like 1B | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 690 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Glycosyltransferase which participates in glycosylation of alpha-dystroglycan. May carry out the synthesis of glycoprotein and glycosphingolipid sugar chains. Has a higher activity toward alpha-dystroglycan than LARGE. Ref.1 |
| Subcellular location | Golgi apparatus membrane; Single-pass type II membrane protein By similarity. |
| Tissue specificity | Highly expressed in the testis and kidney, but weakly expressed in the heart and brain. Expressed during embryogenesis from 7 dpc. Ref.1 |
| Sequence similarities | Belongs to the glycosyltransferase 8 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Golgi apparatus Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal-anchor Transmembrane |
| Molecular function | Glycosyltransferase Transferase |
| PTM | Glycoprotein |
| Gene Ontology (GO) | |
| Cellular component | Golgi apparatus Inferred from electronic annotation. Source: UniProtKB-KW integral to membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | transferase activity, transferring glycosyl groups Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5XPT3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5XPT3-2) The sequence of this isoform differs from the canonical sequence as follows: 193-227: Missing. | ||||||
| Isoform 3 (identifier: Q5XPT3-3) The sequence of this isoform differs from the canonical sequence as follows: 1-61: Missing. 62-93: PPKCEMLHVAIVCAGYNSSREIITLTKSLLFY → MDWAQLLPSMKTRTGVATSPPPARSFYCHPSA | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 690 | 690 | Glycosyltransferase-like protein LARGE2 | PRO_0000226812 | |||||
Regions | |||||||||
| Topological domain | 1 – 8 | 8 | Cytoplasmic Potential | ||||||
| Transmembrane | 9 – 29 | 21 | Signal-anchor for type II membrane protein Potential | ||||||
| Topological domain | 30 – 690 | 661 | Lumenal Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 51 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 78 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 202 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 61 | 61 | Missing in isoform 3. | VSP_017487 | |||||
| Alternative sequence | 62 – 93 | 32 | PPKCE…SLLFY → MDWAQLLPSMKTRTGVATSP PPARSFYCHPSA in isoform 3. | VSP_017488 | |||||
| Alternative sequence | 193 – 227 | 35 | Missing in isoform 2. | VSP_017489 | |||||
Experimental info | |||||||||
| Sequence conflict | 144 | 1 | K → N in BAC36913. Ref.2 | ||||||
| Sequence conflict | 580 | 1 | S → R in AAH33922. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of the LARGE family of putative glycosyltransferases associated with dystroglycanopathies." Grewal P.K., McLaughlan J.M., Moore C.J., Browning C.A., Hewitt J.E. Glycobiology 15:912-923(2005) [PubMed: 15958417] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Strain: C57BL/6. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Strain: C57BL/6J. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: Czech II. Tissue: Lung and Mammary tumor. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AY742914 mRNA. Translation: AAU95213.1. AY742915 mRNA. Translation: AAU95214.1. AK077630 mRNA. Translation: BAC36913.1. AL731709 Genomic DNA. Translation: CAM20620.1. BC033922 mRNA. Translation: AAH33922.1. BC096655 mRNA. Translation: AAH96655.1. | |
| IPI | IPI00222542. IPI00480262. IPI00480499. |
| RefSeq | NP_766258.1. |
| UniGene | Mm.31158 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q5XPT3. |
Protein family/group databases | |
| CAZy | GT49. Glycosyltransferase Family 49. GT8. Glycosyltransferase Family 8. |
Proteomic databases | |
| PRIDE | Q5XPT3. |
Genome annotation databases | |
| Ensembl | ENSMUST00000043868; ENSMUSP00000043156; ENSMUSG00000040434; Mus musculus. [Genome view] ENSMUST00000068586; ENSMUSP00000064128; ENSMUSG00000040434; Mus musculus. [Genome view] ENSMUST00000111284; ENSMUSP00000106915; ENSMUSG00000040434; Mus musculus. [Genome view] |
| GeneID | 228366. |
| KEGG | mmu:228366. |
| UCSC | uc008kxn.1. mouse. uc008kxo.1. mouse. uc008kxp.1. mouse. |
Organism-specific databases | |
| CTD | 228366. |
| MGI | MGI:2443769. Gyltl1b. |
Phylogenomic databases | |
| HOGENOM | Q5XPT3. |
| HOVERGEN | Q5XPT3. |
Gene expression databases | |
| ArrayExpress | Q5XPT3. |
| Bgee | Q5XPT3. |
| CleanEx | MM_GYLTL1B. |
| Genevestigator | Q5XPT3. |
| GermOnline | ENSMUSG00000040434. Mus musculus. |
Family and domain databases | |
| InterPro | IPR002495. Glyco_trans_8. [Graphical view] |
| Pfam | PF01501. Glyco_transf_8. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 378978. |
| SOURCE | Search... |
Entry information
| Entry name | LARG2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q5XPT3 Secondary accession number(s): A2AHG9 Q8K253 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


