Q5XKR9 (F104B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 51.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein FAM104B | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 115 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence similarities | Belongs to the FAM104 family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5XKR9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5XKR9-2) The sequence of this isoform differs from the canonical sequence as follows: 40-40: E → EV | ||||||
| Isoform 3 (identifier: Q5XKR9-3) The sequence of this isoform differs from the canonical sequence as follows: 40-40: E → EV 85-115: LSKPVYVINWFMSFGPEIKLNTSQQGRNQAV → YVPCQGLYSHINQTLKEAHFNSLQQRGQAPT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 115 | 115 | Protein FAM104B | PRO_0000239034 | |||||
Natural variations | |||||||||
| Alternative sequence | 40 | 1 | E → EV in isoform 2 and isoform 3. | VSP_019078 | |||||
| Alternative sequence | 85 – 115 | 31 | LSKPV…RNQAV → YVPCQGLYSHINQTLKEAHF NSLQQRGQAPT in isoform 3. | VSP_019079 | |||||
| Natural variant | 60 | 1 | S → G. Corresponds to variant rs1047037 [ dbSNP | Ensembl ]. | VAR_055796 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed: 15772651] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2-115 (ISOFORM 3). Tissue: Bone marrow, Lung and Placenta. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AL590240 Genomic DNA. Translation: CAI39881.1. CH471154 Genomic DNA. Translation: EAW93218.1. BC000919 mRNA. Translation: AAH00919.2. BC006406 mRNA. Translation: AAH06406.2. BC017571 mRNA. Translation: AAH17571.1. |
| IPI | IPI00395485. IPI00759656. IPI00759746. |
| RefSeq | NP_001160171.1. NM_001166699.1. NP_001160172.1. NM_001166700.1. NP_001160174.1. NM_001166702.1. NP_612371.2. NM_138362.3. |
| UniGene | Hs.415414. |
3D structure databases | |
| ProteinModelPortal | Q5XKR9. |
| ModBase | Search... |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000358460; ENSP00000364101; ENSG00000182518. |
| GeneID | 90736. |
| KEGG | hsa:90736. |
| UCSC | uc004dug.1. human. uc004duh.1. human. uc004dui.2. human. |
Organism-specific databases | |
| CTD | 90736. |
| GeneCards | GC0XM055186. |
| HGNC | HGNC:25085. FAM104B. |
| neXtProt | NX_Q5XKR9. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG21137. |
| GeneTree | ENSGT00390000001055. |
| HOVERGEN | HBG059882. |
| OMA | NQIVTEP. |
| OrthoDB | EOG454910. |
Gene expression databases | |
| ArrayExpress | Q5XKR9. |
| Bgee | Q5XKR9. |
| CleanEx | HS_FAM104B. |
| Genevestigator | Q5XKR9. |
| GermOnline | ENSG00000182518. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| NextBio | 76943. |
Entry information
| Entry name | F104B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5XKR9 Secondary accession number(s): A6NEH1, Q8WVU5, Q9BRA1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with