Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase

Gene

Ngly1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Specifically deglycosylates the denatured form of N-linked glycoproteins in the cytoplasm and assists their proteasome-mediated degradation. Cleaves the beta-aspartyl-glucosamine (GlcNAc) of the glycan and the amide side chain of Asn, converting Asn to Asp. Prefers proteins containing high-mannose over those bearing complex type oligosaccharides. Can recognize misfolded proteins in the endoplasmic reticulum that are exported to the cytosol to be destroyed and deglycosylate them, while it has no activity toward native proteins. Deglycosylation is a prerequisite for subsequent proteasome-mediated degradation of some, but not all, misfolded glycoproteins (By similarity).By similarity

Catalytic activityi

Hydrolysis of an N4-(acetyl-beta-D-glucosaminyl)asparagine residue in which the glucosamine residue may be further glycosylated, to yield a (substituted) N-acetyl-beta-D-glucosaminylamine and a peptide containing an aspartate residue.

Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Enzyme regulationi

Inhibited by Z-VAD-fmk, a well-known caspase inhibitor, which inhibits enzyme activity through covalent binding of the carbohydrate to the single Cys-306 residue.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi247ZincBy similarity1
Metal bindingi250ZincBy similarity1
Metal bindingi280ZincBy similarity1
Metal bindingi283ZincBy similarity1
Active sitei306NucleophileBy similarity1
Active sitei333By similarity1
Active sitei350By similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase
LigandMetal-binding, Zinc

Enzyme and pathway databases

BRENDAi3.5.1.52 5301
ReactomeiR-RNO-532668 N-glycan trimming in the ER and Calnexin/Calreticulin cycle

Names & Taxonomyi

Protein namesi
Recommended name:
Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase (EC:3.5.1.52)
Short name:
PNGase
Alternative name(s):
N-glycanase 1
Peptide:N-glycanase
Gene namesi
Name:Ngly1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 15

Organism-specific databases

RGDi1308518 Ngly1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00002489742 – 651Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidaseAdd BLAST650

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

PaxDbiQ5XI55
PRIDEiQ5XI55

PTM databases

iPTMnetiQ5XI55
PhosphoSitePlusiQ5XI55

Expressioni

Gene expression databases

BgeeiENSRNOG00000006143
GenevisibleiQ5XI55 RN

Interactioni

Subunit structurei

Component of a complex required to couple retrotranslocation, ubiquitination and deglycosylation composed of NGLY1, SAKS1, AMFR, VCP and RAD23B. Interacts with the proteasome components RAD23B and PSMC1. Interacts with directly with VCP. Interacts with DERL1, bringing it close to the endoplasmic reticulum membrane. Interacts with SAKS1 (By similarity).By similarity

Protein-protein interaction databases

BioGridi262367, 1 interactor
STRINGi10116.ENSRNOP00000008289

Structurei

3D structure databases

ProteinModelPortaliQ5XI55
SMRiQ5XI55
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini30 – 91PUBAdd BLAST62
Domaini451 – 651PAWPROSITE-ProRule annotationAdd BLAST201

Domaini

The PUB domain mediates the interaction with VCP.By similarity

Sequence similaritiesi

Belongs to the transglutaminase-like superfamily. PNGase family.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0909 Eukaryota
ENOG410XP69 LUCA
GeneTreeiENSGT00390000006540
HOGENOMiHOG000247069
HOVERGENiHBG082026
InParanoidiQ5XI55
KOiK01456
OMAiVAWQHTQ
OrthoDBiEOG091G09YB
PhylomeDBiQ5XI55

Family and domain databases

Gene3Di2.60.120.1020, 1 hit
InterProiView protein in InterPro
IPR008979 Galactose-bd-like_sf
IPR038680 PAW_sf
IPR006588 Peptide_N_glycanase_PAW_dom
IPR036339 PUB-like_dom_sf
IPR018997 PUB_domain
IPR002931 Transglutaminase-like
PfamiView protein in Pfam
PF04721 PAW, 1 hit
PF09409 PUB, 1 hit
PF01841 Transglut_core, 1 hit
SMARTiView protein in SMART
SM00613 PAW, 1 hit
SM00580 PUG, 1 hit
SM00460 TGc, 1 hit
SUPFAMiSSF143503 SSF143503, 1 hit
SSF49785 SSF49785, 1 hit
PROSITEiView protein in PROSITE
PS51398 PAW, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5XI55-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASATLGSSS SSASPAVAEL CQNTPETFLE ASKLLLTYAD NILRNPSDEK
60 70 80 90 100
YRSIRIGNTA FSTRLLPVRG AVECLFEMGF EEGETHLIFP KKASVEQLQK
110 120 130 140 150
IRDLIAVERR SRLDGSSQKV EFSQHPAAVR LPAEQPEDPT GLMQHSGNQP
160 170 180 190 200
GQPLSLPSAP LVVGDSTIFK VLQSNIQHVQ LYENPVLQEK ALACIPVNEL
210 220 230 240 250
KRKSQEKLFR ARKLDKGTKV SDEDFLLLEL LHWFKEEFFH WVNNVVCSRC
260 270 280 290 300
GRETRSRDEA LPPNDDELKW GAKNVEDHYC DACQLSNRFP RYNNPEKLLE
310 320 330 340 350
TRCGRCGEWA NCFTLCCRAL GFEARYVWDY TDHVWTEVYS PSQQRWLHCD
360 370 380 390 400
ACEDVCDKPL LYEIGWGKKL SYIIAFSKDE VVDVTWRYSC KHEEVMSRRT
410 420 430 440 450
KVKEELLRET INGLNKQRQL LLSESRRKEL LQRIIVELVE FISPKTPRPG
460 470 480 490 500
ELGGRVSGSL AWRVARGETC LERKEILFIP SENEKISKQF HLRYDIVRDR
510 520 530 540 550
YIRVSDNNAN ISGWENGVWK MESIFRKVEK DWNMVYLARK EGSSFAYISW
560 570 580 590 600
KFECGSAGLK VDNVSIRTSS QSFETGSVRW KLRSEMAQVN LLGDRNLRSY
610 620 630 640 650
DDFCGATEVT LEAELSRGDG DVAWQHTQLF RQSLNDHAEN GLEIIITFSD

L
Length:651
Mass (Da):74,677
Last modified:September 5, 2006 - v2
Checksum:i7F080A86D9A4E870
GO
Isoform 2 (identifier: Q5XI55-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     594-651: DRNLRSYDDFCGATEVTLEAELSRGDGDVAWQHTQLFRQSLNDHAENGLEIIITFSDL → GRSRQKSAFL

Note: No experimental confirmation available.
Show »
Length:603
Mass (Da):69,242
Checksum:i12BDDE24D4BEA5A2
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_020347594 – 651DRNLR…TFSDL → GRSRQKSAFL in isoform 2. 1 PublicationAdd BLAST58

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AABR03096885 Genomic DNA No translation available.
AABR03096708 Genomic DNA No translation available.
AABR03096256 Genomic DNA No translation available.
BC083837 mRNA Translation: AAH83837.1
RefSeqiNP_001014158.1, NM_001014136.1 [Q5XI55-2]
UniGeneiRn.108552

Genome annotation databases

EnsembliENSRNOT00000008289; ENSRNOP00000008289; ENSRNOG00000006143 [Q5XI55-1]
GeneIDi361014
KEGGirno:361014

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNGLY1_RAT
AccessioniPrimary (citable) accession number: Q5XI55
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: September 5, 2006
Last modified: April 25, 2018
This is version 101 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health