Q5XHX6 (TXND2_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 70.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Thioredoxin domain-containing protein 2 Alternative name(s): Spermatid-specific thioredoxin-1 Short name=Sptrx-1 | ||||
| Gene names |
| ||||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||||
| Taxonomic identifier | 10116 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 550 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probably plays a regulatory role in sperm development. May participate in regulation of fibrous sheath (FS) assembly by supporting the formation of disulfide bonds during sperm tail morphogenesis. May also be required to rectify incorrect disulfide pairing and generate suitable pairs between the FS constituents. Can reduce disulfide bonds in vitro in the presence of NADP and thioredoxin reductase By similarity. |
| Subcellular location | Cytoplasm By similarity. |
| Tissue specificity | Testis-specific. Strongly expressed in the testicular seminiferous tubules, mostly in the round spermatids. Ref.2 |
| Developmental stage | Transiently expressed in spermiogenesis, being mostly concentrated in the periaxonemal compartment of the tail of the elongating spermatid, where it transiently associates with the longitudinal column of the FS. In the very last steps (steps 17-19), when periaxonemal expression disappears, it is still weakly present in the shrinking cytoplasmic lobe (at protein level). Ref.2 |
| Sequence similarities | Contains 1 thioredoxin domain. |
| Sequence caution | The sequence AAH79238.1 differs from that shown. Reason: Erroneous initiation. The sequence AAH83924.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5XHX6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5XHX6-2) The sequence of this isoform differs from the canonical sequence as follows: 1-43: MFKKNQKLSKDKGLEVNSVQAGAPEESDVKLNNGGKANERGSN → MQSKCGKQANDLKMITELFLK | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 550 | 550 | Thioredoxin domain-containing protein 2 | PRO_0000120155 | |||||||
Regions | |||||||||||
| Repeat | 104 – 118 | 15 | 1 | ||||||||
| Repeat | 119 – 133 | 15 | 2 | ||||||||
| Repeat | 134 – 148 | 15 | 3 | ||||||||
| Repeat | 149 – 163 | 15 | 4 | ||||||||
| Repeat | 164 – 178 | 15 | 5 | ||||||||
| Repeat | 179 – 193 | 15 | 6 | ||||||||
| Repeat | 194 – 208 | 15 | 7 | ||||||||
| Repeat | 209 – 223 | 15 | 8 | ||||||||
| Repeat | 224 – 238 | 15 | 9 | ||||||||
| Repeat | 239 – 252 | 14 | 10 | ||||||||
| Repeat | 253 – 267 | 15 | 11 | ||||||||
| Repeat | 268 – 282 | 15 | 12 | ||||||||
| Repeat | 283 – 297 | 15 | 13 | ||||||||
| Repeat | 298 – 312 | 15 | 14 | ||||||||
| Repeat | 313 – 327 | 15 | 15 | ||||||||
| Repeat | 328 – 342 | 15 | 16 | ||||||||
| Repeat | 343 – 357 | 15 | 17 | ||||||||
| Repeat | 358 – 384 | 27 | 18 | ||||||||
| Repeat | 385 – 399 | 15 | 19 | ||||||||
| Repeat | 400 – 412 | 13 | 20 | ||||||||
| Domain | 401 – 550 | 150 | Thioredoxin | ||||||||
| Repeat | 413 – 425 | 13 | 21 | ||||||||
| Repeat | 426 – 440 | 15 | 22 | ||||||||
| Region | 104 – 440 | 337 | 22 X 15 AA approximate tandem repeat of Q-P-K-X-G-D-I-P-K-S-[PS]-E-[KE]-X-I | ||||||||
Amino acid modifications | |||||||||||
| Disulfide bond | 477 ↔ 480 | Redox-active By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 43 | 43 | MFKKN…ERGSN → MQSKCGKQANDLKMITELFL K in isoform 2. | VSP_014329 | |||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Testis. |
| [2] | "Developmental expression of spermatid-specific thioredoxin-1 protein: transient association to the longitudinal columns of the fibrous sheath during sperm tail formation." Yu Y., Oko R., Miranda-Vizuete A. Biol. Reprod. 67:1546-1554(2002) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | BC079238 mRNA. Translation: AAH79238.1. Different initiation. BC083924 mRNA. Translation: AAH83924.1. Different initiation. |
| IPI | IPI00363611. IPI00608181. |
| RefSeq | NP_001005559.2. NM_001005559.2. NP_001139476.1. NM_001146004.1. |
| UniGene | Rn.122669. |
3D structure databases | |
| ProteinModelPortal | Q5XHX6. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 10116.ENSRNOP00000048534. |
Proteomic databases | |
| PaxDb | Q5XHX6. |
| PRIDE | Q5XHX6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSRNOT00000032330; ENSRNOP00000034030; ENSRNOG00000027916. ENSRNOT00000043492; ENSRNOP00000048534; ENSRNOG00000027916. |
| GeneID | 316777. |
| KEGG | rno:316777. |
| UCSC | RGD:1359251. rat. |
Organism-specific databases | |
| CTD | 84203. |
| RGD | 1359251. Txndc2. |
Phylogenomic databases | |
| eggNOG | COG0526. |
| GeneTree | ENSGT00530000063008. |
| HOGENOM | HOG000154719. |
| HOVERGEN | HBG087115. |
| InParanoid | Q5XHX6. |
| OMA | GNIPKAS. |
| OrthoDB | EOG47PX7J. |
Gene expression databases | |
| Genevestigator | Q5XHX6. |
Family and domain databases | |
| Gene3D | 3.40.30.10. 1 hit. |
| InterPro | IPR005746. Thioredoxin. IPR012336. Thioredoxin-like_fold. IPR013766. Thioredoxin_domain. [Graphical view] |
| PANTHER | PTHR10438. PTHR10438. 1 hit. |
| Pfam | PF00085. Thioredoxin. 1 hit. [Graphical view] |
| SUPFAM | SSF52833. Thiordxn-like_fd. 1 hit. |
| PROSITE | PS00194. THIOREDOXIN_1. False negative. PS51352. THIOREDOXIN_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 671238. |
Entry information
| Entry name | TXND2_RAT | ||||||||
| Accession | Primary (citable) accession number: Q5XHX6 Secondary accession number(s): Q6AY11 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
