Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5XHX6

- TXND2_RAT

UniProt

Q5XHX6 - TXND2_RAT

Protein

Thioredoxin domain-containing protein 2

Gene

Txndc2

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 81 (01 Oct 2014)
      Sequence version 2 (05 Jul 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Probably plays a regulatory role in sperm development. May participate in regulation of fibrous sheath (FS) assembly by supporting the formation of disulfide bonds during sperm tail morphogenesis. May also be required to rectify incorrect disulfide pairing and generate suitable pairs between the FS constituents. Can reduce disulfide bonds in vitro in the presence of NADP and thioredoxin reductase By similarity.By similarity

    GO - Molecular functioni

    1. protein disulfide isomerase activity Source: Ensembl
    2. protein disulfide oxidoreductase activity Source: InterPro

    GO - Biological processi

    1. cell differentiation Source: UniProtKB-KW
    2. cell redox homeostasis Source: InterPro
    3. glycerol ether metabolic process Source: InterPro
    4. multicellular organismal development Source: UniProtKB-KW
    5. spermatogenesis Source: UniProtKB-KW

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Differentiation, Spermatogenesis

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Thioredoxin domain-containing protein 2
    Alternative name(s):
    Spermatid-specific thioredoxin-1
    Short name:
    Sptrx-1
    Gene namesi
    Name:Txndc2
    Synonyms:Sptrx, Sptrx1
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Chromosome 9

    Organism-specific databases

    RGDi1359251. Txndc2.

    Subcellular locationi

    Cytoplasm By similarity

    GO - Cellular componenti

    1. motile cilium Source: Ensembl
    2. nucleolus Source: Ensembl
    3. outer dense fiber Source: RGD

    Keywords - Cellular componenti

    Cytoplasm

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 550550Thioredoxin domain-containing protein 2PRO_0000120155Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi477 ↔ 480Redox-activePROSITE-ProRule annotation

    Keywords - PTMi

    Disulfide bond

    Proteomic databases

    PaxDbiQ5XHX6.
    PRIDEiQ5XHX6.

    Expressioni

    Tissue specificityi

    Testis-specific. Strongly expressed in the testicular seminiferous tubules, mostly in the round spermatids.1 Publication

    Developmental stagei

    Transiently expressed in spermiogenesis, being mostly concentrated in the periaxonemal compartment of the tail of the elongating spermatid, where it transiently associates with the longitudinal column of the FS. In the very last steps (steps 17-19), when periaxonemal expression disappears, it is still weakly present in the shrinking cytoplasmic lobe (at protein level).1 Publication

    Gene expression databases

    GenevestigatoriQ5XHX6.

    Interactioni

    Protein-protein interaction databases

    STRINGi10116.ENSRNOP00000048534.

    Structurei

    3D structure databases

    ProteinModelPortaliQ5XHX6.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati104 – 118151Add
    BLAST
    Repeati119 – 133152Add
    BLAST
    Repeati134 – 148153Add
    BLAST
    Repeati149 – 163154Add
    BLAST
    Repeati164 – 178155Add
    BLAST
    Repeati179 – 193156Add
    BLAST
    Repeati194 – 208157Add
    BLAST
    Repeati209 – 223158Add
    BLAST
    Repeati224 – 238159Add
    BLAST
    Repeati239 – 2521410Add
    BLAST
    Repeati253 – 2671511Add
    BLAST
    Repeati268 – 2821512Add
    BLAST
    Repeati283 – 2971513Add
    BLAST
    Repeati298 – 3121514Add
    BLAST
    Repeati313 – 3271515Add
    BLAST
    Repeati328 – 3421516Add
    BLAST
    Repeati343 – 3571517Add
    BLAST
    Repeati358 – 3842718Add
    BLAST
    Repeati385 – 3991519Add
    BLAST
    Repeati400 – 4121320Add
    BLAST
    Domaini401 – 550150ThioredoxinPROSITE-ProRule annotationAdd
    BLAST
    Repeati413 – 4251321Add
    BLAST
    Repeati426 – 4401522Add
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni104 – 44033722 X 15 AA approximate tandem repeat of Q-P-K-X-G-D-I-P-K-S-[PS]-E-[KE]-X-IAdd
    BLAST

    Sequence similaritiesi

    Contains 1 thioredoxin domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Redox-active center, Repeat

    Phylogenomic databases

    eggNOGiCOG0526.
    GeneTreeiENSGT00530000063008.
    HOGENOMiHOG000154719.
    HOVERGENiHBG087115.
    InParanoidiQ5XHX6.
    OMAiKTIPPKQ.
    OrthoDBiEOG7H4DX9.
    PhylomeDBiQ5XHX6.
    TreeFamiTF106377.

    Family and domain databases

    Gene3Di3.40.30.10. 1 hit.
    InterProiIPR005746. Thioredoxin.
    IPR012336. Thioredoxin-like_fold.
    IPR013766. Thioredoxin_domain.
    [Graphical view]
    PANTHERiPTHR10438. PTHR10438. 1 hit.
    PfamiPF00085. Thioredoxin. 1 hit.
    [Graphical view]
    SUPFAMiSSF52833. SSF52833. 1 hit.
    PROSITEiPS51352. THIOREDOXIN_2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5XHX6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MFKKNQKLSK DKGLEVNSVQ AGAPEESDVK LNNGGKANER GSNEFLDTAQ    50
    SKEKVIASVV GNMLHMSTEE SEPPQQVSST SMFSENTIYP KHEGSPKSST 100
    KNTQLKQEDI SKTSSYSKQT NSSNIPKSLA ITTYPKQGST LKPAANGTHD 150
    REAEKPKSSE DLIQSKKGDI FKPSEDSIQS KKGDMPKSSE DPIQSKKDDT 200
    AKSLEDTIQS KNGDMPKSSE DPIQSKKDDT ARSLEDSIQS KKGDMPKSSD 250
    TIQSKESETP KFLQDTIQSK GGKINKQVKD SMKSKESKIR KPLKDSIQSK 300
    ENKIPKSSQD SAQPKEGKIH KPLKDSLPSK EGDISKPSED TIQAKEEITV 350
    SPEDTIQAKE EITMSPEDTI QAKEEITVSP EDTIQAKEEI TVSPEDTMQS 400
    KEEITVSPED TVQSQEGDIK SSEDVQPSEN EIFPFEAEIE TLEEGMVRVI 450
    KDKEEFEEVL KDAGEKLVAV DFSAPWCGPC RKMRPHFHSL SLKHEDVIFL 500
    EVDTEDCEQL VQDCEVFHLP TFQFYKNEEK VGEFSGALVE KLEKSIAELK 550
    Length:550
    Mass (Da):61,103
    Last modified:July 5, 2005 - v2
    Checksum:i5F624DF65422E2A4
    GO
    Isoform 2 (identifier: Q5XHX6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-43: MFKKNQKLSKDKGLEVNSVQAGAPEESDVKLNNGGKANERGSN → MQSKCGKQANDLKMITELFLK

    Note: No experimental confirmation available.

    Show »
    Length:528
    Mass (Da):58,912
    Checksum:i66FADB8840623C35
    GO

    Sequence cautioni

    The sequence AAH79238.1 differs from that shown. Reason: Erroneous initiation.
    The sequence AAH83924.1 differs from that shown. Reason: Erroneous initiation.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4343MFKKN…ERGSN → MQSKCGKQANDLKMITELFL K in isoform 2. 1 PublicationVSP_014329Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    BC079238 mRNA. Translation: AAH79238.1. Different initiation.
    BC083924 mRNA. Translation: AAH83924.1. Different initiation.
    RefSeqiNP_001005559.2. NM_001005559.2.
    NP_001139476.1. NM_001146004.1. [Q5XHX6-1]
    XP_006245669.1. XM_006245607.1. [Q5XHX6-2]
    UniGeneiRn.122669.

    Genome annotation databases

    EnsembliENSRNOT00000032330; ENSRNOP00000034030; ENSRNOG00000027916. [Q5XHX6-2]
    ENSRNOT00000043492; ENSRNOP00000048534; ENSRNOG00000027916. [Q5XHX6-1]
    GeneIDi316777.
    KEGGirno:316777.
    UCSCiRGD:1359251. rat. [Q5XHX6-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    BC079238 mRNA. Translation: AAH79238.1 . Different initiation.
    BC083924 mRNA. Translation: AAH83924.1 . Different initiation.
    RefSeqi NP_001005559.2. NM_001005559.2.
    NP_001139476.1. NM_001146004.1. [Q5XHX6-1 ]
    XP_006245669.1. XM_006245607.1. [Q5XHX6-2 ]
    UniGenei Rn.122669.

    3D structure databases

    ProteinModelPortali Q5XHX6.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 10116.ENSRNOP00000048534.

    Proteomic databases

    PaxDbi Q5XHX6.
    PRIDEi Q5XHX6.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSRNOT00000032330 ; ENSRNOP00000034030 ; ENSRNOG00000027916 . [Q5XHX6-2 ]
    ENSRNOT00000043492 ; ENSRNOP00000048534 ; ENSRNOG00000027916 . [Q5XHX6-1 ]
    GeneIDi 316777.
    KEGGi rno:316777.
    UCSCi RGD:1359251. rat. [Q5XHX6-1 ]

    Organism-specific databases

    CTDi 84203.
    RGDi 1359251. Txndc2.

    Phylogenomic databases

    eggNOGi COG0526.
    GeneTreei ENSGT00530000063008.
    HOGENOMi HOG000154719.
    HOVERGENi HBG087115.
    InParanoidi Q5XHX6.
    OMAi KTIPPKQ.
    OrthoDBi EOG7H4DX9.
    PhylomeDBi Q5XHX6.
    TreeFami TF106377.

    Miscellaneous databases

    NextBioi 671238.
    PROi Q5XHX6.

    Gene expression databases

    Genevestigatori Q5XHX6.

    Family and domain databases

    Gene3Di 3.40.30.10. 1 hit.
    InterProi IPR005746. Thioredoxin.
    IPR012336. Thioredoxin-like_fold.
    IPR013766. Thioredoxin_domain.
    [Graphical view ]
    PANTHERi PTHR10438. PTHR10438. 1 hit.
    Pfami PF00085. Thioredoxin. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52833. SSF52833. 1 hit.
    PROSITEi PS51352. THIOREDOXIN_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Testis.
    2. "Developmental expression of spermatid-specific thioredoxin-1 protein: transient association to the longitudinal columns of the fibrous sheath during sperm tail formation."
      Yu Y., Oko R., Miranda-Vizuete A.
      Biol. Reprod. 67:1546-1554(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.

    Entry informationi

    Entry nameiTXND2_RAT
    AccessioniPrimary (citable) accession number: Q5XHX6
    Secondary accession number(s): Q6AY11
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 5, 2005
    Last sequence update: July 5, 2005
    Last modified: October 1, 2014
    This is version 81 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3