Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5XHX6

- TXND2_RAT

UniProt

Q5XHX6 - TXND2_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Thioredoxin domain-containing protein 2

Gene

Txndc2

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Probably plays a regulatory role in sperm development. May participate in regulation of fibrous sheath (FS) assembly by supporting the formation of disulfide bonds during sperm tail morphogenesis. May also be required to rectify incorrect disulfide pairing and generate suitable pairs between the FS constituents. Can reduce disulfide bonds in vitro in the presence of NADP and thioredoxin reductase By similarity.By similarity

GO - Molecular functioni

  1. protein disulfide isomerase activity Source: Ensembl
  2. protein disulfide oxidoreductase activity Source: InterPro

GO - Biological processi

  1. cell differentiation Source: UniProtKB-KW
  2. cell redox homeostasis Source: InterPro
  3. glycerol ether metabolic process Source: InterPro
  4. multicellular organismal development Source: UniProtKB-KW
  5. spermatogenesis Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Spermatogenesis

Names & Taxonomyi

Protein namesi
Recommended name:
Thioredoxin domain-containing protein 2
Alternative name(s):
Spermatid-specific thioredoxin-1
Short name:
Sptrx-1
Gene namesi
Name:Txndc2
Synonyms:Sptrx, Sptrx1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Chromosome 9

Organism-specific databases

RGDi1359251. Txndc2.

Subcellular locationi

Cytoplasm By similarity

GO - Cellular componenti

  1. motile cilium Source: Ensembl
  2. nucleolus Source: Ensembl
  3. outer dense fiber Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 550550Thioredoxin domain-containing protein 2PRO_0000120155Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi477 ↔ 480Redox-activePROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiQ5XHX6.
PRIDEiQ5XHX6.

Expressioni

Tissue specificityi

Testis-specific. Strongly expressed in the testicular seminiferous tubules, mostly in the round spermatids.1 Publication

Developmental stagei

Transiently expressed in spermiogenesis, being mostly concentrated in the periaxonemal compartment of the tail of the elongating spermatid, where it transiently associates with the longitudinal column of the FS. In the very last steps (steps 17-19), when periaxonemal expression disappears, it is still weakly present in the shrinking cytoplasmic lobe (at protein level).1 Publication

Gene expression databases

ExpressionAtlasiQ5XHX6. baseline.
GenevestigatoriQ5XHX6.

Interactioni

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000048534.

Structurei

3D structure databases

ProteinModelPortaliQ5XHX6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati104 – 118151Add
BLAST
Repeati119 – 133152Add
BLAST
Repeati134 – 148153Add
BLAST
Repeati149 – 163154Add
BLAST
Repeati164 – 178155Add
BLAST
Repeati179 – 193156Add
BLAST
Repeati194 – 208157Add
BLAST
Repeati209 – 223158Add
BLAST
Repeati224 – 238159Add
BLAST
Repeati239 – 2521410Add
BLAST
Repeati253 – 2671511Add
BLAST
Repeati268 – 2821512Add
BLAST
Repeati283 – 2971513Add
BLAST
Repeati298 – 3121514Add
BLAST
Repeati313 – 3271515Add
BLAST
Repeati328 – 3421516Add
BLAST
Repeati343 – 3571517Add
BLAST
Repeati358 – 3842718Add
BLAST
Repeati385 – 3991519Add
BLAST
Repeati400 – 4121320Add
BLAST
Domaini401 – 550150ThioredoxinPROSITE-ProRule annotationAdd
BLAST
Repeati413 – 4251321Add
BLAST
Repeati426 – 4401522Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni104 – 44033722 X 15 AA approximate tandem repeat of Q-P-K-X-G-D-I-P-K-S-[PS]-E-[KE]-X-IAdd
BLAST

Sequence similaritiesi

Contains 1 thioredoxin domain.PROSITE-ProRule annotation

Keywords - Domaini

Redox-active center, Repeat

Phylogenomic databases

eggNOGiCOG0526.
GeneTreeiENSGT00530000063008.
HOGENOMiHOG000154719.
HOVERGENiHBG087115.
InParanoidiQ5XHX6.
OMAiKTIPPKQ.
OrthoDBiEOG7H4DX9.
PhylomeDBiQ5XHX6.
TreeFamiTF106377.

Family and domain databases

Gene3Di3.40.30.10. 1 hit.
InterProiIPR005746. Thioredoxin.
IPR012336. Thioredoxin-like_fold.
IPR013766. Thioredoxin_domain.
[Graphical view]
PANTHERiPTHR10438. PTHR10438. 1 hit.
PfamiPF00085. Thioredoxin. 1 hit.
[Graphical view]
SUPFAMiSSF52833. SSF52833. 1 hit.
PROSITEiPS51352. THIOREDOXIN_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5XHX6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFKKNQKLSK DKGLEVNSVQ AGAPEESDVK LNNGGKANER GSNEFLDTAQ
60 70 80 90 100
SKEKVIASVV GNMLHMSTEE SEPPQQVSST SMFSENTIYP KHEGSPKSST
110 120 130 140 150
KNTQLKQEDI SKTSSYSKQT NSSNIPKSLA ITTYPKQGST LKPAANGTHD
160 170 180 190 200
REAEKPKSSE DLIQSKKGDI FKPSEDSIQS KKGDMPKSSE DPIQSKKDDT
210 220 230 240 250
AKSLEDTIQS KNGDMPKSSE DPIQSKKDDT ARSLEDSIQS KKGDMPKSSD
260 270 280 290 300
TIQSKESETP KFLQDTIQSK GGKINKQVKD SMKSKESKIR KPLKDSIQSK
310 320 330 340 350
ENKIPKSSQD SAQPKEGKIH KPLKDSLPSK EGDISKPSED TIQAKEEITV
360 370 380 390 400
SPEDTIQAKE EITMSPEDTI QAKEEITVSP EDTIQAKEEI TVSPEDTMQS
410 420 430 440 450
KEEITVSPED TVQSQEGDIK SSEDVQPSEN EIFPFEAEIE TLEEGMVRVI
460 470 480 490 500
KDKEEFEEVL KDAGEKLVAV DFSAPWCGPC RKMRPHFHSL SLKHEDVIFL
510 520 530 540 550
EVDTEDCEQL VQDCEVFHLP TFQFYKNEEK VGEFSGALVE KLEKSIAELK
Length:550
Mass (Da):61,103
Last modified:July 5, 2005 - v2
Checksum:i5F624DF65422E2A4
GO
Isoform 2 (identifier: Q5XHX6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MFKKNQKLSKDKGLEVNSVQAGAPEESDVKLNNGGKANERGSN → MQSKCGKQANDLKMITELFLK

Note: No experimental confirmation available.

Show »
Length:528
Mass (Da):58,912
Checksum:i66FADB8840623C35
GO

Sequence cautioni

The sequence AAH79238.1 differs from that shown. Reason: Erroneous initiation.
The sequence AAH83924.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4343MFKKN…ERGSN → MQSKCGKQANDLKMITELFL K in isoform 2. 1 PublicationVSP_014329Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
BC079238 mRNA. Translation: AAH79238.1. Different initiation.
BC083924 mRNA. Translation: AAH83924.1. Different initiation.
RefSeqiNP_001005559.2. NM_001005559.2.
NP_001139476.1. NM_001146004.1. [Q5XHX6-1]
XP_006245669.1. XM_006245607.2. [Q5XHX6-2]
UniGeneiRn.122669.

Genome annotation databases

EnsembliENSRNOT00000032330; ENSRNOP00000034030; ENSRNOG00000027916. [Q5XHX6-2]
ENSRNOT00000043492; ENSRNOP00000048534; ENSRNOG00000027916. [Q5XHX6-1]
GeneIDi316777.
KEGGirno:316777.
UCSCiRGD:1359251. rat. [Q5XHX6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
BC079238 mRNA. Translation: AAH79238.1 . Different initiation.
BC083924 mRNA. Translation: AAH83924.1 . Different initiation.
RefSeqi NP_001005559.2. NM_001005559.2.
NP_001139476.1. NM_001146004.1. [Q5XHX6-1 ]
XP_006245669.1. XM_006245607.2. [Q5XHX6-2 ]
UniGenei Rn.122669.

3D structure databases

ProteinModelPortali Q5XHX6.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 10116.ENSRNOP00000048534.

Proteomic databases

PaxDbi Q5XHX6.
PRIDEi Q5XHX6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSRNOT00000032330 ; ENSRNOP00000034030 ; ENSRNOG00000027916 . [Q5XHX6-2 ]
ENSRNOT00000043492 ; ENSRNOP00000048534 ; ENSRNOG00000027916 . [Q5XHX6-1 ]
GeneIDi 316777.
KEGGi rno:316777.
UCSCi RGD:1359251. rat. [Q5XHX6-1 ]

Organism-specific databases

CTDi 84203.
RGDi 1359251. Txndc2.

Phylogenomic databases

eggNOGi COG0526.
GeneTreei ENSGT00530000063008.
HOGENOMi HOG000154719.
HOVERGENi HBG087115.
InParanoidi Q5XHX6.
OMAi KTIPPKQ.
OrthoDBi EOG7H4DX9.
PhylomeDBi Q5XHX6.
TreeFami TF106377.

Miscellaneous databases

NextBioi 671238.
PROi Q5XHX6.

Gene expression databases

ExpressionAtlasi Q5XHX6. baseline.
Genevestigatori Q5XHX6.

Family and domain databases

Gene3Di 3.40.30.10. 1 hit.
InterProi IPR005746. Thioredoxin.
IPR012336. Thioredoxin-like_fold.
IPR013766. Thioredoxin_domain.
[Graphical view ]
PANTHERi PTHR10438. PTHR10438. 1 hit.
Pfami PF00085. Thioredoxin. 1 hit.
[Graphical view ]
SUPFAMi SSF52833. SSF52833. 1 hit.
PROSITEi PS51352. THIOREDOXIN_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Testis.
  2. "Developmental expression of spermatid-specific thioredoxin-1 protein: transient association to the longitudinal columns of the fibrous sheath during sperm tail formation."
    Yu Y., Oko R., Miranda-Vizuete A.
    Biol. Reprod. 67:1546-1554(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.

Entry informationi

Entry nameiTXND2_RAT
AccessioniPrimary (citable) accession number: Q5XHX6
Secondary accession number(s): Q6AY11
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: July 5, 2005
Last modified: October 29, 2014
This is version 82 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3