Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5XHX6 (TXND2_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 78. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Thioredoxin domain-containing protein 2
Alternative name(s):
Spermatid-specific thioredoxin-1
Short name=Sptrx-1
Gene names
Name:Txndc2
Synonyms:Sptrx, Sptrx1
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length550 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Probably plays a regulatory role in sperm development. May participate in regulation of fibrous sheath (FS) assembly by supporting the formation of disulfide bonds during sperm tail morphogenesis. May also be required to rectify incorrect disulfide pairing and generate suitable pairs between the FS constituents. Can reduce disulfide bonds in vitro in the presence of NADP and thioredoxin reductase By similarity.

Subcellular location

Cytoplasm By similarity.

Tissue specificity

Testis-specific. Strongly expressed in the testicular seminiferous tubules, mostly in the round spermatids. Ref.2

Developmental stage

Transiently expressed in spermiogenesis, being mostly concentrated in the periaxonemal compartment of the tail of the elongating spermatid, where it transiently associates with the longitudinal column of the FS. In the very last steps (steps 17-19), when periaxonemal expression disappears, it is still weakly present in the shrinking cytoplasmic lobe (at protein level). Ref.2

Sequence similarities

Contains 1 thioredoxin domain.

Sequence caution

The sequence AAH79238.1 differs from that shown. Reason: Erroneous initiation.

The sequence AAH83924.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q5XHX6-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q5XHX6-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MFKKNQKLSKDKGLEVNSVQAGAPEESDVKLNNGGKANERGSN → MQSKCGKQANDLKMITELFLK
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 550550Thioredoxin domain-containing protein 2
PRO_0000120155

Regions

Repeat104 – 118151
Repeat119 – 133152
Repeat134 – 148153
Repeat149 – 163154
Repeat164 – 178155
Repeat179 – 193156
Repeat194 – 208157
Repeat209 – 223158
Repeat224 – 238159
Repeat239 – 2521410
Repeat253 – 2671511
Repeat268 – 2821512
Repeat283 – 2971513
Repeat298 – 3121514
Repeat313 – 3271515
Repeat328 – 3421516
Repeat343 – 3571517
Repeat358 – 3842718
Repeat385 – 3991519
Repeat400 – 4121320
Domain401 – 550150Thioredoxin
Repeat413 – 4251321
Repeat426 – 4401522
Region104 – 44033722 X 15 AA approximate tandem repeat of Q-P-K-X-G-D-I-P-K-S-[PS]-E-[KE]-X-I

Amino acid modifications

Disulfide bond477 ↔ 480Redox-active By similarity

Natural variations

Alternative sequence1 – 4343MFKKN…ERGSN → MQSKCGKQANDLKMITELFL K in isoform 2.
VSP_014329

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 5, 2005. Version 2.
Checksum: 5F624DF65422E2A4

FASTA55061,103
        10         20         30         40         50         60 
MFKKNQKLSK DKGLEVNSVQ AGAPEESDVK LNNGGKANER GSNEFLDTAQ SKEKVIASVV 

        70         80         90        100        110        120 
GNMLHMSTEE SEPPQQVSST SMFSENTIYP KHEGSPKSST KNTQLKQEDI SKTSSYSKQT 

       130        140        150        160        170        180 
NSSNIPKSLA ITTYPKQGST LKPAANGTHD REAEKPKSSE DLIQSKKGDI FKPSEDSIQS 

       190        200        210        220        230        240 
KKGDMPKSSE DPIQSKKDDT AKSLEDTIQS KNGDMPKSSE DPIQSKKDDT ARSLEDSIQS 

       250        260        270        280        290        300 
KKGDMPKSSD TIQSKESETP KFLQDTIQSK GGKINKQVKD SMKSKESKIR KPLKDSIQSK 

       310        320        330        340        350        360 
ENKIPKSSQD SAQPKEGKIH KPLKDSLPSK EGDISKPSED TIQAKEEITV SPEDTIQAKE 

       370        380        390        400        410        420 
EITMSPEDTI QAKEEITVSP EDTIQAKEEI TVSPEDTMQS KEEITVSPED TVQSQEGDIK 

       430        440        450        460        470        480 
SSEDVQPSEN EIFPFEAEIE TLEEGMVRVI KDKEEFEEVL KDAGEKLVAV DFSAPWCGPC 

       490        500        510        520        530        540 
RKMRPHFHSL SLKHEDVIFL EVDTEDCEQL VQDCEVFHLP TFQFYKNEEK VGEFSGALVE 

       550 
KLEKSIAELK 

« Hide

Isoform 2 [UniParc].

Checksum: 66FADB8840623C35
Show »

FASTA52858,912

References

« Hide 'large scale' references
[1]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Testis.
[2]"Developmental expression of spermatid-specific thioredoxin-1 protein: transient association to the longitudinal columns of the fibrous sheath during sperm tail formation."
Yu Y., Oko R., Miranda-Vizuete A.
Biol. Reprod. 67:1546-1554(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
BC079238 mRNA. Translation: AAH79238.1. Different initiation.
BC083924 mRNA. Translation: AAH83924.1. Different initiation.
RefSeqNP_001005559.2. NM_001005559.2.
NP_001139476.1. NM_001146004.1.
XP_006245669.1. XM_006245607.1.
UniGeneRn.122669.

3D structure databases

ProteinModelPortalQ5XHX6.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING10116.ENSRNOP00000048534.

Proteomic databases

PaxDbQ5XHX6.
PRIDEQ5XHX6.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSRNOT00000032330; ENSRNOP00000034030; ENSRNOG00000027916. [Q5XHX6-2]
ENSRNOT00000043492; ENSRNOP00000048534; ENSRNOG00000027916. [Q5XHX6-1]
GeneID316777.
KEGGrno:316777.
UCSCRGD:1359251. rat. [Q5XHX6-1]

Organism-specific databases

CTD84203.
RGD1359251. Txndc2.

Phylogenomic databases

eggNOGCOG0526.
GeneTreeENSGT00530000063008.
HOGENOMHOG000154719.
HOVERGENHBG087115.
InParanoidQ5XHX6.
OMAKTIPPKQ.
OrthoDBEOG7H4DX9.
PhylomeDBQ5XHX6.
TreeFamTF106377.

Gene expression databases

GenevestigatorQ5XHX6.

Family and domain databases

Gene3D3.40.30.10. 1 hit.
InterProIPR005746. Thioredoxin.
IPR012336. Thioredoxin-like_fold.
IPR013766. Thioredoxin_domain.
[Graphical view]
PANTHERPTHR10438. PTHR10438. 1 hit.
PfamPF00085. Thioredoxin. 1 hit.
[Graphical view]
SUPFAMSSF52833. SSF52833. 1 hit.
PROSITEPS51352. THIOREDOXIN_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio671238.
PROQ5XHX6.

Entry information

Entry nameTXND2_RAT
AccessionPrimary (citable) accession number: Q5XHX6
Secondary accession number(s): Q6AY11
Entry history
Integrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: July 5, 2005
Last modified: April 16, 2014
This is version 78 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families