Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5XG92 (EST4A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 85. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Carboxylesterase 4A

EC=3.1.1.-
Gene names
Name:CES4A
Synonyms:CES8
ORF Names:UNQ440/PRO873
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length561 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Probable carboxylesterase By similarity.

Subcellular location

Secreted Potential.

Sequence similarities

Belongs to the type-B carboxylesterase/lipase family.

Sequence caution

The sequence AAQ88868.1 differs from that shown. Reason: Chimeric cDNA.

The sequence BAH12248.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Ontologies

Keywords
   Cellular componentSecreted
   Coding sequence diversityAlternative splicing
   DomainSignal
   Molecular functionHydrolase
Serine esterase
   PTMDisulfide bond
Glycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentextracellular region

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionhydrolase activity

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q5XG92-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: Gene prediction based on similarity to mouse ortholog.
Isoform 2 (identifier: Q5XG92-2)

The sequence of this isoform differs from the canonical sequence as follows:
     361-387: Missing.
     439-481: Missing.
Note: No experimental confirmation available. Inactive.
Isoform 3 (identifier: Q5XG92-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-194: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 4 (identifier: Q5XG92-5)

The sequence of this isoform differs from the canonical sequence as follows:
     439-468: DAGLPVYLYEFEHHARGIIVKPRTDGADHG → ETPMMGICPAGHATTRMKSTCSWILPQEWA
     469-561: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: Q5XG92-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-98: Missing.
Note: No experimental confirmation available.
Isoform 6 (identifier: Q5XG92-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-98: Missing.
     179-179: S → RWRGR
     439-468: DAGLPVYLYEFEHHARGIIVKPRTDGADHG → ETPMMGICPAGHATTRMKSTCSWILPQEWA
     469-561: Missing.
Note: No experimental confirmation available.
Isoform 7 (identifier: Q5XG92-8)

The sequence of this isoform differs from the canonical sequence as follows:
     87-87: G → GWSLALSPGWSAVARSRLTATSASRVQASLLPQPLSVWGYR
     361-387: Missing.
     439-468: DAGLPVYLYEFEHHARGIIVKPRTDGADHG → ETPMMGICPAGHATTRMKSTCSWILPQEWA
     469-561: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2020 Potential
Chain21 – 561541Carboxylesterase 4A
PRO_0000325923

Sites

Active site2211Acyl-ester intermediate By similarity
Active site3531Charge relay system By similarity
Active site4671Charge relay system By similarity

Amino acid modifications

Glycosylation2141N-linked (GlcNAc...) Potential
Glycosylation2761N-linked (GlcNAc...) Potential
Glycosylation3881N-linked (GlcNAc...) Potential
Disulfide bond88 ↔ 116 By similarity
Disulfide bond273 ↔ 284 By similarity

Natural variations

Alternative sequence1 – 194194Missing in isoform 3.
VSP_032480
Alternative sequence1 – 9898Missing in isoform 5 and isoform 6.
VSP_040063
Alternative sequence871G → GWSLALSPGWSAVARSRLTA TSASRVQASLLPQPLSVWGY R in isoform 7.
VSP_040064
Alternative sequence1791S → RWRGR in isoform 6.
VSP_040065
Alternative sequence361 – 38727Missing in isoform 2 and isoform 7.
VSP_032483
Alternative sequence439 – 48143Missing in isoform 2.
VSP_032485
Alternative sequence439 – 46830DAGLP…GADHG → ETPMMGICPAGHATTRMKST CSWILPQEWA in isoform 4, isoform 6 and isoform 7.
VSP_040066
Alternative sequence469 – 56193Missing in isoform 4, isoform 6 and isoform 7.
VSP_040067

Experimental info

Sequence conflict2541L → P in BAC04422. Ref.1
Sequence conflict2651K → N in BAH12248. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 18, 2008. Version 2.
Checksum: 27A4CFA5EBE0BC3A

FASTA56163,529
        10         20         30         40         50         60 
MRWILCWSLT LCLMAQTALG ALHTKRPQVV TKYGTLQGKQ MHVGKTPIQV FLGVPFSRPP 

        70         80         90        100        110        120 
LGILRFAPPE PPEPWKGIRD ATTYPPGCLQ ESWGQLASMY VSTRERYKWL RFSEDCLYLN 

       130        140        150        160        170        180 
VYAPARAPGD PQLPVMVWFP GGAFIVGAAS SYEGSDLAAR EKVVLVFLQH RLGIFGFLST 

       190        200        210        220        230        240 
DDSHARGNWG LLDQMAALRW VQENIAAFGG DPGNVTLFGQ SAGAMSISGL MMSPLASGLF 

       250        260        270        280        290        300 
HRAISQSGTA LFRLFITSNP LKVAKKVAHL AGCNHNSTQI LVNCLRALSG TKVMRVSNKM 

       310        320        330        340        350        360 
RFLQLNFQRD PEEIIWSMSP VVDGVVIPDD PLVLLTQGKV SSVPYLLGVN NLEFNWLLPY 

       370        380        390        400        410        420 
IMKFPLNRQA MRKETITKML WSTRTLLNIT KEQVPLVVEE YLDNVNEHDW KMLRNRMMDI 

       430        440        450        460        470        480 
VQDATFVYAT LQTAHYHRDA GLPVYLYEFE HHARGIIVKP RTDGADHGDE MYFLFGGPFA 

       490        500        510        520        530        540 
TGLSMGKEKA LSLQMMKYWA NFARTGNPND GNLPCWPRYN KDEKYLQLDF TTRVGMKLKE 

       550        560 
KKMAFWMSLY QSQRPEKQRQ F 

« Hide

Isoform 2 [UniParc].

Checksum: BF4A69B04F0671C9
Show »

FASTA49155,445
Isoform 3 [UniParc].

Checksum: 85271A21B6B2FF65
Show »

FASTA36741,868
Isoform 4 [UniParc].

Checksum: 890EBC869CBF3414
Show »

FASTA46852,484
Isoform 5 [UniParc].

Checksum: 9A0C691050DC8CCB
Show »

FASTA46352,649
Isoform 6 [UniParc].

Checksum: FC27F9D9DEA3C899
Show »

FASTA37442,229
Isoform 7 [UniParc].

Checksum: DB8FB20E087A0E22
Show »

FASTA48153,504

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4; 5 AND 6).
Tissue: Hippocampus, Neuroepithelioma, Thalamus and Uterus.
[2]"The sequence and analysis of duplication-rich human chromosome 16."
Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. expand/collapse author list , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 20-561 (ISOFORM 7).
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 38-561 (ISOFORM 2).
Tissue: Blood.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK094783 mRNA. Translation: BAC04422.1.
AK293061 mRNA. Translation: BAF85750.1.
AK295483 mRNA. Translation: BAH12085.1.
AK296064 mRNA. Translation: BAH12248.1. Different initiation.
AK300792 mRNA. Translation: BAH13349.1.
AC009084 Genomic DNA. No translation available.
AY358504 mRNA. Translation: AAQ88868.1. Sequence problems.
BC084555 mRNA. Translation: AAH84555.1.
CCDSCCDS42174.3. [Q5XG92-5]
CCDS54024.1. [Q5XG92-6]
CCDS54025.1. [Q5XG92-7]
RefSeqNP_001177130.1. NM_001190201.1. [Q5XG92-6]
NP_001177131.1. NM_001190202.1. [Q5XG92-7]
NP_776176.5. NM_173815.6. [Q5XG92-5]
XP_005255954.1. XM_005255897.1. [Q5XG92-4]
UniGeneHs.346947.
Hs.734986.

3D structure databases

ProteinModelPortalQ5XG92.
SMRQ5XG92. Positions 27-550.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid129682. 1 interaction.
STRING9606.ENSP00000381397.

Protein family/group databases

MEROPSS09.959.

Polymorphism databases

DMDM172045957.

Proteomic databases

MaxQBQ5XG92.
PaxDbQ5XG92.
PRIDEQ5XG92.

Protocols and materials databases

DNASU283848.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000326686; ENSP00000314145; ENSG00000172824. [Q5XG92-1]
ENST00000398354; ENSP00000381397; ENSG00000172824. [Q5XG92-2]
ENST00000535696; ENSP00000441644; ENSG00000172824. [Q5XG92-7]
ENST00000538199; ENSP00000441103; ENSG00000172824.
ENST00000540579; ENSP00000441907; ENSG00000172824. [Q5XG92-6]
ENST00000540947; ENSP00000444052; ENSG00000172824. [Q5XG92-5]
GeneID283848.
KEGGhsa:283848.
UCSCuc002eqw.3. human. [Q5XG92-8]
uc002eqx.3. human. [Q5XG92-1]
uc010vix.2. human. [Q5XG92-5]
uc010viy.2. human. [Q5XG92-7]

Organism-specific databases

CTD283848.
GeneCardsGC16P067023.
HGNCHGNC:26741. CES4A.
HPAHPA035701.
neXtProtNX_Q5XG92.
PharmGKBPA164717904.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG2272.
HOVERGENHBG008839.
OMAMLWSTRT.
OrthoDBEOG7HMS0F.
PhylomeDBQ5XG92.
TreeFamTF315470.

Gene expression databases

ArrayExpressQ5XG92.
BgeeQ5XG92.
GenevestigatorQ5XG92.

Family and domain databases

Gene3D3.40.50.1820. 1 hit.
InterProIPR029058. AB_hydrolase.
IPR002018. CarbesteraseB.
IPR019826. Carboxylesterase_B_AS.
IPR019819. Carboxylesterase_B_CS.
[Graphical view]
PfamPF00135. COesterase. 1 hit.
[Graphical view]
SUPFAMSSF53474. SSF53474. 1 hit.
PROSITEPS00122. CARBOXYLESTERASE_B_1. 1 hit.
PS00941. CARBOXYLESTERASE_B_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSCES4A. human.
GenomeRNAi283848.
NextBio94282.
PROQ5XG92.

Entry information

Entry nameEST4A_HUMAN
AccessionPrimary (citable) accession number: Q5XG92
Secondary accession number(s): A8KAJ6 expand/collapse secondary AC list , B7Z349, B7Z3L2, B7Z6R3, Q6UX55, Q8N9F4
Entry history
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 18, 2008
Last modified: July 9, 2014
This is version 85 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 16

Human chromosome 16: entries, gene names and cross-references to MIM