Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5XG92

- EST4A_HUMAN

UniProt

Q5XG92 - EST4A_HUMAN

Protein

Carboxylesterase 4A

Gene

CES4A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 86 (01 Oct 2014)
      Sequence version 2 (18 Mar 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Probable carboxylesterase.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei221 – 2211Acyl-ester intermediatePROSITE-ProRule annotation
    Active sitei353 – 3531Charge relay systemBy similarity
    Active sitei467 – 4671Charge relay systemBy similarity

    GO - Molecular functioni

    1. hydrolase activity Source: UniProtKB-KW

    Keywords - Molecular functioni

    Hydrolase, Serine esterase

    Protein family/group databases

    MEROPSiS09.959.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Carboxylesterase 4A (EC:3.1.1.-)
    Gene namesi
    Name:CES4A
    Synonyms:CES8
    ORF Names:UNQ440/PRO873
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:26741. CES4A.

    Subcellular locationi

    Secreted Curated

    GO - Cellular componenti

    1. extracellular region Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA164717904.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2020Sequence AnalysisAdd
    BLAST
    Chaini21 – 561541Carboxylesterase 4APRO_0000325923Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi88 ↔ 116By similarity
    Glycosylationi214 – 2141N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi273 ↔ 284By similarity
    Glycosylationi276 – 2761N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi388 – 3881N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiQ5XG92.
    PaxDbiQ5XG92.
    PRIDEiQ5XG92.

    Expressioni

    Gene expression databases

    ArrayExpressiQ5XG92.
    BgeeiQ5XG92.
    GenevestigatoriQ5XG92.

    Organism-specific databases

    HPAiHPA035701.

    Interactioni

    Protein-protein interaction databases

    BioGridi129682. 1 interaction.
    STRINGi9606.ENSP00000381397.

    Structurei

    3D structure databases

    ProteinModelPortaliQ5XG92.
    SMRiQ5XG92. Positions 27-550.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiCOG2272.
    HOVERGENiHBG008839.
    OMAiMLWSTRT.
    OrthoDBiEOG7HMS0F.
    PhylomeDBiQ5XG92.
    TreeFamiTF315470.

    Family and domain databases

    Gene3Di3.40.50.1820. 1 hit.
    InterProiIPR029058. AB_hydrolase.
    IPR002018. CarbesteraseB.
    IPR019826. Carboxylesterase_B_AS.
    IPR019819. Carboxylesterase_B_CS.
    [Graphical view]
    PfamiPF00135. COesterase. 1 hit.
    [Graphical view]
    SUPFAMiSSF53474. SSF53474. 1 hit.
    PROSITEiPS00122. CARBOXYLESTERASE_B_1. 1 hit.
    PS00941. CARBOXYLESTERASE_B_2. 1 hit.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5XG92-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRWILCWSLT LCLMAQTALG ALHTKRPQVV TKYGTLQGKQ MHVGKTPIQV    50
    FLGVPFSRPP LGILRFAPPE PPEPWKGIRD ATTYPPGCLQ ESWGQLASMY 100
    VSTRERYKWL RFSEDCLYLN VYAPARAPGD PQLPVMVWFP GGAFIVGAAS 150
    SYEGSDLAAR EKVVLVFLQH RLGIFGFLST DDSHARGNWG LLDQMAALRW 200
    VQENIAAFGG DPGNVTLFGQ SAGAMSISGL MMSPLASGLF HRAISQSGTA 250
    LFRLFITSNP LKVAKKVAHL AGCNHNSTQI LVNCLRALSG TKVMRVSNKM 300
    RFLQLNFQRD PEEIIWSMSP VVDGVVIPDD PLVLLTQGKV SSVPYLLGVN 350
    NLEFNWLLPY IMKFPLNRQA MRKETITKML WSTRTLLNIT KEQVPLVVEE 400
    YLDNVNEHDW KMLRNRMMDI VQDATFVYAT LQTAHYHRDA GLPVYLYEFE 450
    HHARGIIVKP RTDGADHGDE MYFLFGGPFA TGLSMGKEKA LSLQMMKYWA 500
    NFARTGNPND GNLPCWPRYN KDEKYLQLDF TTRVGMKLKE KKMAFWMSLY 550
    QSQRPEKQRQ F 561

    Note: Gene prediction based on similarity to mouse ortholog.

    Length:561
    Mass (Da):63,529
    Last modified:March 18, 2008 - v2
    Checksum:i27A4CFA5EBE0BC3A
    GO
    Isoform 2 (identifier: Q5XG92-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         361-387: Missing.
         439-481: Missing.

    Note: No experimental confirmation available. Inactive.

    Show »
    Length:491
    Mass (Da):55,445
    Checksum:iBF4A69B04F0671C9
    GO
    Isoform 3 (identifier: Q5XG92-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-194: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:367
    Mass (Da):41,868
    Checksum:i85271A21B6B2FF65
    GO
    Isoform 4 (identifier: Q5XG92-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         439-468: DAGLPVYLYEFEHHARGIIVKPRTDGADHG → ETPMMGICPAGHATTRMKSTCSWILPQEWA
         469-561: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:468
    Mass (Da):52,484
    Checksum:i890EBC869CBF3414
    GO
    Isoform 5 (identifier: Q5XG92-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-98: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:463
    Mass (Da):52,649
    Checksum:i9A0C691050DC8CCB
    GO
    Isoform 6 (identifier: Q5XG92-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-98: Missing.
         179-179: S → RWRGR
         439-468: DAGLPVYLYEFEHHARGIIVKPRTDGADHG → ETPMMGICPAGHATTRMKSTCSWILPQEWA
         469-561: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:374
    Mass (Da):42,229
    Checksum:iFC27F9D9DEA3C899
    GO
    Isoform 7 (identifier: Q5XG92-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         87-87: G → GWSLALSPGWSAVARSRLTATSASRVQASLLPQPLSVWGYR
         361-387: Missing.
         439-468: DAGLPVYLYEFEHHARGIIVKPRTDGADHG → ETPMMGICPAGHATTRMKSTCSWILPQEWA
         469-561: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:481
    Mass (Da):53,504
    Checksum:iDB8FB20E087A0E22
    GO

    Sequence cautioni

    The sequence AAQ88868.1 differs from that shown. Reason: Chimeric cDNA.
    The sequence BAH12248.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti254 – 2541L → P in BAC04422. (PubMed:14702039)Curated
    Sequence conflicti265 – 2651K → N in BAH12248. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 194194Missing in isoform 3. 1 PublicationVSP_032480Add
    BLAST
    Alternative sequencei1 – 9898Missing in isoform 5 and isoform 6. 1 PublicationVSP_040063Add
    BLAST
    Alternative sequencei87 – 871G → GWSLALSPGWSAVARSRLTA TSASRVQASLLPQPLSVWGY R in isoform 7. 1 PublicationVSP_040064
    Alternative sequencei179 – 1791S → RWRGR in isoform 6. 1 PublicationVSP_040065
    Alternative sequencei361 – 38727Missing in isoform 2 and isoform 7. 2 PublicationsVSP_032483Add
    BLAST
    Alternative sequencei439 – 48143Missing in isoform 2. 1 PublicationVSP_032485Add
    BLAST
    Alternative sequencei439 – 46830DAGLP…GADHG → ETPMMGICPAGHATTRMKST CSWILPQEWA in isoform 4, isoform 6 and isoform 7. 2 PublicationsVSP_040066Add
    BLAST
    Alternative sequencei469 – 56193Missing in isoform 4, isoform 6 and isoform 7. 2 PublicationsVSP_040067Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK094783 mRNA. Translation: BAC04422.1.
    AK293061 mRNA. Translation: BAF85750.1.
    AK295483 mRNA. Translation: BAH12085.1.
    AK296064 mRNA. Translation: BAH12248.1. Different initiation.
    AK300792 mRNA. Translation: BAH13349.1.
    AC009084 Genomic DNA. No translation available.
    AY358504 mRNA. Translation: AAQ88868.1. Sequence problems.
    BC084555 mRNA. Translation: AAH84555.1.
    CCDSiCCDS42174.3. [Q5XG92-5]
    CCDS54024.1. [Q5XG92-6]
    CCDS54025.1. [Q5XG92-7]
    RefSeqiNP_001177130.1. NM_001190201.1. [Q5XG92-6]
    NP_001177131.1. NM_001190202.1. [Q5XG92-7]
    NP_776176.5. NM_173815.6. [Q5XG92-5]
    XP_005255954.1. XM_005255897.1. [Q5XG92-4]
    UniGeneiHs.346947.
    Hs.734986.

    Genome annotation databases

    EnsembliENST00000535696; ENSP00000441644; ENSG00000172824. [Q5XG92-7]
    ENST00000538199; ENSP00000441103; ENSG00000172824.
    ENST00000540579; ENSP00000441907; ENSG00000172824. [Q5XG92-6]
    ENST00000540947; ENSP00000444052; ENSG00000172824. [Q5XG92-5]
    GeneIDi283848.
    KEGGihsa:283848.
    UCSCiuc002eqw.3. human. [Q5XG92-8]
    uc002eqx.3. human. [Q5XG92-1]
    uc010vix.2. human. [Q5XG92-5]
    uc010viy.2. human. [Q5XG92-7]

    Polymorphism databases

    DMDMi172045957.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK094783 mRNA. Translation: BAC04422.1 .
    AK293061 mRNA. Translation: BAF85750.1 .
    AK295483 mRNA. Translation: BAH12085.1 .
    AK296064 mRNA. Translation: BAH12248.1 . Different initiation.
    AK300792 mRNA. Translation: BAH13349.1 .
    AC009084 Genomic DNA. No translation available.
    AY358504 mRNA. Translation: AAQ88868.1 . Sequence problems.
    BC084555 mRNA. Translation: AAH84555.1 .
    CCDSi CCDS42174.3. [Q5XG92-5 ]
    CCDS54024.1. [Q5XG92-6 ]
    CCDS54025.1. [Q5XG92-7 ]
    RefSeqi NP_001177130.1. NM_001190201.1. [Q5XG92-6 ]
    NP_001177131.1. NM_001190202.1. [Q5XG92-7 ]
    NP_776176.5. NM_173815.6. [Q5XG92-5 ]
    XP_005255954.1. XM_005255897.1. [Q5XG92-4 ]
    UniGenei Hs.346947.
    Hs.734986.

    3D structure databases

    ProteinModelPortali Q5XG92.
    SMRi Q5XG92. Positions 27-550.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 129682. 1 interaction.
    STRINGi 9606.ENSP00000381397.

    Protein family/group databases

    MEROPSi S09.959.

    Polymorphism databases

    DMDMi 172045957.

    Proteomic databases

    MaxQBi Q5XG92.
    PaxDbi Q5XG92.
    PRIDEi Q5XG92.

    Protocols and materials databases

    DNASUi 283848.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000535696 ; ENSP00000441644 ; ENSG00000172824 . [Q5XG92-7 ]
    ENST00000538199 ; ENSP00000441103 ; ENSG00000172824 .
    ENST00000540579 ; ENSP00000441907 ; ENSG00000172824 . [Q5XG92-6 ]
    ENST00000540947 ; ENSP00000444052 ; ENSG00000172824 . [Q5XG92-5 ]
    GeneIDi 283848.
    KEGGi hsa:283848.
    UCSCi uc002eqw.3. human. [Q5XG92-8 ]
    uc002eqx.3. human. [Q5XG92-1 ]
    uc010vix.2. human. [Q5XG92-5 ]
    uc010viy.2. human. [Q5XG92-7 ]

    Organism-specific databases

    CTDi 283848.
    GeneCardsi GC16P067023.
    HGNCi HGNC:26741. CES4A.
    HPAi HPA035701.
    neXtProti NX_Q5XG92.
    PharmGKBi PA164717904.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2272.
    HOVERGENi HBG008839.
    OMAi MLWSTRT.
    OrthoDBi EOG7HMS0F.
    PhylomeDBi Q5XG92.
    TreeFami TF315470.

    Miscellaneous databases

    ChiTaRSi CES4A. human.
    GenomeRNAii 283848.
    NextBioi 94282.
    PROi Q5XG92.

    Gene expression databases

    ArrayExpressi Q5XG92.
    Bgeei Q5XG92.
    Genevestigatori Q5XG92.

    Family and domain databases

    Gene3Di 3.40.50.1820. 1 hit.
    InterProi IPR029058. AB_hydrolase.
    IPR002018. CarbesteraseB.
    IPR019826. Carboxylesterase_B_AS.
    IPR019819. Carboxylesterase_B_CS.
    [Graphical view ]
    Pfami PF00135. COesterase. 1 hit.
    [Graphical view ]
    SUPFAMi SSF53474. SSF53474. 1 hit.
    PROSITEi PS00122. CARBOXYLESTERASE_B_1. 1 hit.
    PS00941. CARBOXYLESTERASE_B_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4; 5 AND 6).
      Tissue: Hippocampus, Neuroepithelioma, Thalamus and Uterus.
    2. "The sequence and analysis of duplication-rich human chromosome 16."
      Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
      , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
      Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 20-561 (ISOFORM 7).
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 38-561 (ISOFORM 2).
      Tissue: Blood.

    Entry informationi

    Entry nameiEST4A_HUMAN
    AccessioniPrimary (citable) accession number: Q5XG92
    Secondary accession number(s): A8KAJ6
    , B7Z349, B7Z3L2, B7Z6R3, Q6UX55, Q8N9F4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 18, 2008
    Last sequence update: March 18, 2008
    Last modified: October 1, 2014
    This is version 86 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3