SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5XG92

- EST4A_HUMAN

UniProt

Q5XG92 - EST4A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Carboxylesterase 4A

Gene
CES4A, CES8, UNQ440/PRO873
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

Probable carboxylesterase By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei221 – 2211Acyl-ester intermediate By similarity
Active sitei353 – 3531Charge relay system By similarity
Active sitei467 – 4671Charge relay system By similarity

GO - Molecular functioni

  1. hydrolase activity Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Serine esterase

Protein family/group databases

MEROPSiS09.959.

Names & Taxonomyi

Protein namesi
Recommended name:
Carboxylesterase 4A (EC:3.1.1.-)
Gene namesi
Name:CES4A
Synonyms:CES8
ORF Names:UNQ440/PRO873
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:26741. CES4A.

Subcellular locationi

Secreted Reviewed prediction

GO - Cellular componenti

  1. extracellular region Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164717904.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2020 Reviewed predictionAdd
BLAST
Chaini21 – 561541Carboxylesterase 4APRO_0000325923Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi88 ↔ 116 By similarity
Glycosylationi214 – 2141N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi273 ↔ 284 By similarity
Glycosylationi276 – 2761N-linked (GlcNAc...) Reviewed prediction
Glycosylationi388 – 3881N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ5XG92.
PaxDbiQ5XG92.
PRIDEiQ5XG92.

Expressioni

Gene expression databases

ArrayExpressiQ5XG92.
BgeeiQ5XG92.
GenevestigatoriQ5XG92.

Organism-specific databases

HPAiHPA035701.

Interactioni

Protein-protein interaction databases

BioGridi129682. 1 interaction.
STRINGi9606.ENSP00000381397.

Structurei

3D structure databases

ProteinModelPortaliQ5XG92.
SMRiQ5XG92. Positions 27-550.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiCOG2272.
HOVERGENiHBG008839.
OMAiMLWSTRT.
OrthoDBiEOG7HMS0F.
PhylomeDBiQ5XG92.
TreeFamiTF315470.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR002018. CarbesteraseB.
IPR019826. Carboxylesterase_B_AS.
IPR019819. Carboxylesterase_B_CS.
[Graphical view]
PfamiPF00135. COesterase. 1 hit.
[Graphical view]
SUPFAMiSSF53474. SSF53474. 1 hit.
PROSITEiPS00122. CARBOXYLESTERASE_B_1. 1 hit.
PS00941. CARBOXYLESTERASE_B_2. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5XG92-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MRWILCWSLT LCLMAQTALG ALHTKRPQVV TKYGTLQGKQ MHVGKTPIQV    50
FLGVPFSRPP LGILRFAPPE PPEPWKGIRD ATTYPPGCLQ ESWGQLASMY 100
VSTRERYKWL RFSEDCLYLN VYAPARAPGD PQLPVMVWFP GGAFIVGAAS 150
SYEGSDLAAR EKVVLVFLQH RLGIFGFLST DDSHARGNWG LLDQMAALRW 200
VQENIAAFGG DPGNVTLFGQ SAGAMSISGL MMSPLASGLF HRAISQSGTA 250
LFRLFITSNP LKVAKKVAHL AGCNHNSTQI LVNCLRALSG TKVMRVSNKM 300
RFLQLNFQRD PEEIIWSMSP VVDGVVIPDD PLVLLTQGKV SSVPYLLGVN 350
NLEFNWLLPY IMKFPLNRQA MRKETITKML WSTRTLLNIT KEQVPLVVEE 400
YLDNVNEHDW KMLRNRMMDI VQDATFVYAT LQTAHYHRDA GLPVYLYEFE 450
HHARGIIVKP RTDGADHGDE MYFLFGGPFA TGLSMGKEKA LSLQMMKYWA 500
NFARTGNPND GNLPCWPRYN KDEKYLQLDF TTRVGMKLKE KKMAFWMSLY 550
QSQRPEKQRQ F 561

Note: Gene prediction based on similarity to mouse ortholog.

Length:561
Mass (Da):63,529
Last modified:March 18, 2008 - v2
Checksum:i27A4CFA5EBE0BC3A
GO
Isoform 2 (identifier: Q5XG92-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     361-387: Missing.
     439-481: Missing.

Note: No experimental confirmation available. Inactive.

Show »
Length:491
Mass (Da):55,445
Checksum:iBF4A69B04F0671C9
GO
Isoform 3 (identifier: Q5XG92-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-194: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:367
Mass (Da):41,868
Checksum:i85271A21B6B2FF65
GO
Isoform 4 (identifier: Q5XG92-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     439-468: DAGLPVYLYEFEHHARGIIVKPRTDGADHG → ETPMMGICPAGHATTRMKSTCSWILPQEWA
     469-561: Missing.

Note: No experimental confirmation available.

Show »
Length:468
Mass (Da):52,484
Checksum:i890EBC869CBF3414
GO
Isoform 5 (identifier: Q5XG92-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-98: Missing.

Note: No experimental confirmation available.

Show »
Length:463
Mass (Da):52,649
Checksum:i9A0C691050DC8CCB
GO
Isoform 6 (identifier: Q5XG92-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-98: Missing.
     179-179: S → RWRGR
     439-468: DAGLPVYLYEFEHHARGIIVKPRTDGADHG → ETPMMGICPAGHATTRMKSTCSWILPQEWA
     469-561: Missing.

Note: No experimental confirmation available.

Show »
Length:374
Mass (Da):42,229
Checksum:iFC27F9D9DEA3C899
GO
Isoform 7 (identifier: Q5XG92-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-87: G → GWSLALSPGWSAVARSRLTATSASRVQASLLPQPLSVWGYR
     361-387: Missing.
     439-468: DAGLPVYLYEFEHHARGIIVKPRTDGADHG → ETPMMGICPAGHATTRMKSTCSWILPQEWA
     469-561: Missing.

Note: No experimental confirmation available.

Show »
Length:481
Mass (Da):53,504
Checksum:iDB8FB20E087A0E22
GO

Sequence cautioni

The sequence AAQ88868.1 differs from that shown. Reason: Chimeric cDNA.
The sequence BAH12248.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 194194Missing in isoform 3. VSP_032480Add
BLAST
Alternative sequencei1 – 9898Missing in isoform 5 and isoform 6. VSP_040063Add
BLAST
Alternative sequencei87 – 871G → GWSLALSPGWSAVARSRLTA TSASRVQASLLPQPLSVWGY R in isoform 7. VSP_040064
Alternative sequencei179 – 1791S → RWRGR in isoform 6. VSP_040065
Alternative sequencei361 – 38727Missing in isoform 2 and isoform 7. VSP_032483Add
BLAST
Alternative sequencei439 – 48143Missing in isoform 2. VSP_032485Add
BLAST
Alternative sequencei439 – 46830DAGLP…GADHG → ETPMMGICPAGHATTRMKST CSWILPQEWA in isoform 4, isoform 6 and isoform 7. VSP_040066Add
BLAST
Alternative sequencei469 – 56193Missing in isoform 4, isoform 6 and isoform 7. VSP_040067Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti254 – 2541L → P in BAC04422. 1 Publication
Sequence conflicti265 – 2651K → N in BAH12248. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK094783 mRNA. Translation: BAC04422.1.
AK293061 mRNA. Translation: BAF85750.1.
AK295483 mRNA. Translation: BAH12085.1.
AK296064 mRNA. Translation: BAH12248.1. Different initiation.
AK300792 mRNA. Translation: BAH13349.1.
AC009084 Genomic DNA. No translation available.
AY358504 mRNA. Translation: AAQ88868.1. Sequence problems.
BC084555 mRNA. Translation: AAH84555.1.
CCDSiCCDS42174.3. [Q5XG92-5]
CCDS54024.1. [Q5XG92-6]
CCDS54025.1. [Q5XG92-7]
RefSeqiNP_001177130.1. NM_001190201.1. [Q5XG92-6]
NP_001177131.1. NM_001190202.1. [Q5XG92-7]
NP_776176.5. NM_173815.6. [Q5XG92-5]
XP_005255954.1. XM_005255897.1. [Q5XG92-4]
UniGeneiHs.346947.
Hs.734986.

Genome annotation databases

EnsembliENST00000326686; ENSP00000314145; ENSG00000172824. [Q5XG92-1]
ENST00000398354; ENSP00000381397; ENSG00000172824. [Q5XG92-2]
ENST00000535696; ENSP00000441644; ENSG00000172824. [Q5XG92-7]
ENST00000538199; ENSP00000441103; ENSG00000172824.
ENST00000540579; ENSP00000441907; ENSG00000172824. [Q5XG92-6]
ENST00000540947; ENSP00000444052; ENSG00000172824. [Q5XG92-5]
GeneIDi283848.
KEGGihsa:283848.
UCSCiuc002eqw.3. human. [Q5XG92-8]
uc002eqx.3. human. [Q5XG92-1]
uc010vix.2. human. [Q5XG92-5]
uc010viy.2. human. [Q5XG92-7]

Polymorphism databases

DMDMi172045957.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK094783 mRNA. Translation: BAC04422.1 .
AK293061 mRNA. Translation: BAF85750.1 .
AK295483 mRNA. Translation: BAH12085.1 .
AK296064 mRNA. Translation: BAH12248.1 . Different initiation.
AK300792 mRNA. Translation: BAH13349.1 .
AC009084 Genomic DNA. No translation available.
AY358504 mRNA. Translation: AAQ88868.1 . Sequence problems.
BC084555 mRNA. Translation: AAH84555.1 .
CCDSi CCDS42174.3. [Q5XG92-5 ]
CCDS54024.1. [Q5XG92-6 ]
CCDS54025.1. [Q5XG92-7 ]
RefSeqi NP_001177130.1. NM_001190201.1. [Q5XG92-6 ]
NP_001177131.1. NM_001190202.1. [Q5XG92-7 ]
NP_776176.5. NM_173815.6. [Q5XG92-5 ]
XP_005255954.1. XM_005255897.1. [Q5XG92-4 ]
UniGenei Hs.346947.
Hs.734986.

3D structure databases

ProteinModelPortali Q5XG92.
SMRi Q5XG92. Positions 27-550.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 129682. 1 interaction.
STRINGi 9606.ENSP00000381397.

Protein family/group databases

MEROPSi S09.959.

Polymorphism databases

DMDMi 172045957.

Proteomic databases

MaxQBi Q5XG92.
PaxDbi Q5XG92.
PRIDEi Q5XG92.

Protocols and materials databases

DNASUi 283848.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000326686 ; ENSP00000314145 ; ENSG00000172824 . [Q5XG92-1 ]
ENST00000398354 ; ENSP00000381397 ; ENSG00000172824 . [Q5XG92-2 ]
ENST00000535696 ; ENSP00000441644 ; ENSG00000172824 . [Q5XG92-7 ]
ENST00000538199 ; ENSP00000441103 ; ENSG00000172824 .
ENST00000540579 ; ENSP00000441907 ; ENSG00000172824 . [Q5XG92-6 ]
ENST00000540947 ; ENSP00000444052 ; ENSG00000172824 . [Q5XG92-5 ]
GeneIDi 283848.
KEGGi hsa:283848.
UCSCi uc002eqw.3. human. [Q5XG92-8 ]
uc002eqx.3. human. [Q5XG92-1 ]
uc010vix.2. human. [Q5XG92-5 ]
uc010viy.2. human. [Q5XG92-7 ]

Organism-specific databases

CTDi 283848.
GeneCardsi GC16P067023.
HGNCi HGNC:26741. CES4A.
HPAi HPA035701.
neXtProti NX_Q5XG92.
PharmGKBi PA164717904.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2272.
HOVERGENi HBG008839.
OMAi MLWSTRT.
OrthoDBi EOG7HMS0F.
PhylomeDBi Q5XG92.
TreeFami TF315470.

Miscellaneous databases

ChiTaRSi CES4A. human.
GenomeRNAii 283848.
NextBioi 94282.
PROi Q5XG92.

Gene expression databases

ArrayExpressi Q5XG92.
Bgeei Q5XG92.
Genevestigatori Q5XG92.

Family and domain databases

Gene3Di 3.40.50.1820. 1 hit.
InterProi IPR029058. AB_hydrolase.
IPR002018. CarbesteraseB.
IPR019826. Carboxylesterase_B_AS.
IPR019819. Carboxylesterase_B_CS.
[Graphical view ]
Pfami PF00135. COesterase. 1 hit.
[Graphical view ]
SUPFAMi SSF53474. SSF53474. 1 hit.
PROSITEi PS00122. CARBOXYLESTERASE_B_1. 1 hit.
PS00941. CARBOXYLESTERASE_B_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4; 5 AND 6).
    Tissue: Hippocampus, Neuroepithelioma, Thalamus and Uterus.
  2. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 20-561 (ISOFORM 7).
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 38-561 (ISOFORM 2).
    Tissue: Blood.

Entry informationi

Entry nameiEST4A_HUMAN
AccessioniPrimary (citable) accession number: Q5XG92
Secondary accession number(s): A8KAJ6
, B7Z349, B7Z3L2, B7Z6R3, Q6UX55, Q8N9F4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 18, 2008
Last modified: July 9, 2014
This is version 85 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi