Q5XG92 (EST4A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 74.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Carboxylesterase 4A EC=3.1.1.- | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 561 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Probable carboxylesterase By similarity. |
| Subcellular location | Secreted Potential. |
| Sequence similarities | Belongs to the type-B carboxylesterase/lipase family. |
| Sequence caution | The sequence AAQ88868.1 differs from that shown. Reason: Chimeric cDNA. The sequence BAH12248.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal |
| Molecular function | Hydrolase Serine esterase |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | carboxylesterase activity Inferred from Biological aspect of Ancestor. Source: RefGenome |
| Complete GO annotation... | |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5XG92-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Gene prediction based on similarity to mouse ortholog. | ||||||
| Isoform 2 (identifier: Q5XG92-2) The sequence of this isoform differs from the canonical sequence as follows: 361-387: Missing. 439-481: Missing. | ||||||
| Note: No experimental confirmation available. Inactive. | ||||||
| Isoform 3 (identifier: Q5XG92-4) The sequence of this isoform differs from the canonical sequence as follows: 1-194: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 4 (identifier: Q5XG92-5) The sequence of this isoform differs from the canonical sequence as follows: 439-468: DAGLPVYLYEFEHHARGIIVKPRTDGADHG → ETPMMGICPAGHATTRMKSTCSWILPQEWA 469-561: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q5XG92-6) The sequence of this isoform differs from the canonical sequence as follows: 1-98: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: Q5XG92-7) The sequence of this isoform differs from the canonical sequence as follows: 1-98: Missing. 179-179: S → RWRGR 439-468: DAGLPVYLYEFEHHARGIIVKPRTDGADHG → ETPMMGICPAGHATTRMKSTCSWILPQEWA 469-561: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: Q5XG92-8) The sequence of this isoform differs from the canonical sequence as follows: 87-87: G → GWSLALSPGWSAVARSRLTATSASRVQASLLPQPLSVWGYR 361-387: Missing. 439-468: DAGLPVYLYEFEHHARGIIVKPRTDGADHG → ETPMMGICPAGHATTRMKSTCSWILPQEWA 469-561: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 20 | 20 | Potential | ||||||||
| Chain | 21 – 561 | 541 | Carboxylesterase 4A | PRO_0000325923 | |||||||
Sites | |||||||||||
| Active site | 221 | 1 | Acyl-ester intermediate By similarity | ||||||||
| Active site | 353 | 1 | Charge relay system By similarity | ||||||||
| Active site | 467 | 1 | Charge relay system By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 214 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 276 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 388 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 88 ↔ 116 | By similarity | |||||||||
| Disulfide bond | 273 ↔ 284 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 194 | 194 | Missing in isoform 3. | VSP_032480 | |||||||
| Alternative sequence | 1 – 98 | 98 | Missing in isoform 5 and isoform 6. | VSP_040063 | |||||||
| Alternative sequence | 87 | 1 | G → GWSLALSPGWSAVARSRLTA TSASRVQASLLPQPLSVWGY R in isoform 7. | VSP_040064 | |||||||
| Alternative sequence | 179 | 1 | S → RWRGR in isoform 6. | VSP_040065 | |||||||
| Alternative sequence | 361 – 387 | 27 | Missing in isoform 2 and isoform 7. | VSP_032483 | |||||||
| Alternative sequence | 439 – 481 | 43 | Missing in isoform 2. | VSP_032485 | |||||||
| Alternative sequence | 439 – 468 | 30 | DAGLP…GADHG → ETPMMGICPAGHATTRMKST CSWILPQEWA in isoform 4, isoform 6 and isoform 7. | VSP_040066 | |||||||
| Alternative sequence | 469 – 561 | 93 | Missing in isoform 4, isoform 6 and isoform 7. | VSP_040067 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 254 | 1 | L → P in BAC04422. Ref.1 | ||||||||
| Sequence conflict | 265 | 1 | K → N in BAH12248. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4; 5 AND 6). Tissue: Hippocampus, Neuroepithelioma, Thalamus and Uterus. |
| [2] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 20-561 (ISOFORM 7). |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 38-561 (ISOFORM 2). Tissue: Blood. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK094783 mRNA. Translation: BAC04422.1. AK293061 mRNA. Translation: BAF85750.1. AK295483 mRNA. Translation: BAH12085.1. AK296064 mRNA. Translation: BAH12248.1. Different initiation. AK300792 mRNA. Translation: BAH13349.1. AC009084 Genomic DNA. No translation available. AY358504 mRNA. Translation: AAQ88868.1. Sequence problems. BC084555 mRNA. Translation: AAH84555.1. |
| IPI | IPI00167706. IPI00411985. IPI00640345. IPI00872564. IPI00971162. IPI00973041. IPI00973352. |
| RefSeq | NP_001177130.1. NM_001190201.1. NP_001177131.1. NM_001190202.1. NP_776176.5. NM_173815.6. |
| UniGene | Hs.346947. Hs.734986. |
3D structure databases | |
| ProteinModelPortal | Q5XG92. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000381397. |
Protein family/group databases | |
| MEROPS | S09.959. |
Polymorphism databases | |
| DMDM | 172045957. |
Proteomic databases | |
| PaxDb | Q5XG92. |
| PRIDE | Q5XG92. |
Protocols and materials databases | |
| DNASU | 283848. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000326686; ENSP00000314145; ENSG00000172824. ENST00000398354; ENSP00000381397; ENSG00000172824. ENST00000535696; ENSP00000441644; ENSG00000172824. ENST00000538199; ENSP00000441103; ENSG00000172824. ENST00000540579; ENSP00000441907; ENSG00000172824. ENST00000540947; ENSP00000444052; ENSG00000172824. |
| GeneID | 283848. |
| KEGG | hsa:283848. |
| UCSC | uc002eqw.3. human. uc002eqx.3. human. uc010vix.2. human. uc010viy.2. human. |
Organism-specific databases | |
| CTD | 283848. |
| GeneCards | GC16P067023. |
| HGNC | HGNC:26741. CES4A. |
| HPA | HPA035701. |
| neXtProt | NX_Q5XG92. |
| PharmGKB | PA164717904. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG2272. |
| HOVERGEN | HBG008839. |
| OMA | NNAMARR. |
| OrthoDB | EOG4M91R4. |
Gene expression databases | |
| ArrayExpress | Q5XG92. |
| Bgee | Q5XG92. |
| Genevestigator | Q5XG92. |
Family and domain databases | |
| InterPro | IPR002018. CarbesteraseB. IPR019826. Carboxylesterase_B_AS. IPR019819. Carboxylesterase_B_CS. [Graphical view] |
| Pfam | PF00135. COesterase. 1 hit. [Graphical view] |
| PROSITE | PS00122. CARBOXYLESTERASE_B_1. 1 hit. PS00941. CARBOXYLESTERASE_B_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | CES4A. human. |
| GenomeRNAi | 283848. |
| NextBio | 94282. |
Entry information
| Entry name | EST4A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5XG92 Secondary accession number(s): A8KAJ6 Q8N9F4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
