Q5XF89 (AT133_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 89.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Probable cation-transporting ATPase 13A3 EC=3.6.3.- | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1219 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Catalytic activity | ATP + H2O = ADP + phosphate. |
| Subcellular location | Membrane; Multi-pass membrane protein By similarity. |
| Tissue specificity | Expression is greatest in liver, followed by kidney, colon, stomach, brain and small intestine. Isoform 1 is highly expressed in the kidney while isoform 2 is highly expressed in the brain. Ref.1 |
| Sequence similarities | Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type V subfamily. [View classification] |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Ligand | ATP-binding Magnesium Metal-binding Nucleotide-binding |
| Molecular function | Hydrolase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | ATP catabolic process Inferred from electronic annotation. Source: GOC |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW cation-transporting ATPase activityInferred from electronic annotation. Source: InterPro metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5XF89-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5XF89-2) The sequence of this isoform differs from the canonical sequence as follows: 1154-1154: E → ESFFLDTVLWKVVFNRDKQGECRFSTTQPPQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1219 | 1219 | Probable cation-transporting ATPase 13A3 | PRO_0000363358 | |||||
Regions | |||||||||
| Transmembrane | 29 – 49 | 21 | Helical; Potential | ||||||
| Transmembrane | 202 – 222 | 21 | Helical; Potential | ||||||
| Transmembrane | 229 – 249 | 21 | Helical; Potential | ||||||
| Transmembrane | 406 – 426 | 21 | Helical; Potential | ||||||
| Transmembrane | 445 – 465 | 21 | Helical; Potential | ||||||
| Transmembrane | 937 – 957 | 21 | Helical; Potential | ||||||
| Transmembrane | 959 – 979 | 21 | Helical; Potential | ||||||
| Transmembrane | 996 – 1016 | 21 | Helical; Potential | ||||||
| Transmembrane | 1067 – 1087 | 21 | Helical; Potential | ||||||
| Transmembrane | 1099 – 1119 | 21 | Helical; Potential | ||||||
| Transmembrane | 1137 – 1157 | 21 | Helical; Potential | ||||||
| Compositional bias | 227 – 230 | 4 | Poly-Tyr | ||||||
Sites | |||||||||
| Active site | 494 | 1 | 4-aspartylphosphate intermediate By similarity | ||||||
| Metal binding | 879 | 1 | Magnesium By similarity | ||||||
| Metal binding | 883 | 1 | Magnesium By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 813 | 1 | Phosphoserine Ref.2 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1154 | 1 | E → ESFFLDTVLWKVVFNRDKQG ECRFSTTQPPQ in isoform 2. | VSP_036301 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of the P5 subfamily of P-type transport ATPases in mice." Schultheis P.J., Hagen T.T., O'Toole K.K., Tachibana A., Burke C.R., McGill D.L., Okunade G.W., Shull G.E. Biochem. Biophys. Res. Commun. 323:731-738(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY. |
| [2] | "The phagosomal proteome in interferon-gamma-activated macrophages." Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P. Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-813, MASS SPECTROMETRY. Tissue: Macrophage. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | BK005558 mRNA. Translation: DAA05589.1. |
| IPI | IPI00665580. IPI00850873. |
| RefSeq | NP_001121566.1. NM_001128094.1. NP_001121568.1. NM_001128096.1. |
| UniGene | Mm.8924. |
3D structure databases | |
| ProteinModelPortal | Q5XF89. |
| SMR | Q5XF89. Positions 174-760, 852-1008. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 10090.ENSMUSP00000051645. |
PTM databases | |
| PhosphoSite | Q5XF89. |
Proteomic databases | |
| PaxDb | Q5XF89. |
| PRIDE | Q5XF89. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000061350; ENSMUSP00000051645; ENSMUSG00000022533. ENSMUST00000100013; ENSMUSP00000128224; ENSMUSG00000022533. |
| GeneID | 224088. |
| KEGG | mmu:224088. |
| UCSC | uc012aee.1. mouse. uc012aef.1. mouse. |
Organism-specific databases | |
| CTD | 79572. |
| MGI | MGI:2685387. Atp13a3. |
Phylogenomic databases | |
| eggNOG | COG0474. |
| GeneTree | ENSGT00530000063001. |
| HOGENOM | HOG000171813. |
| HOVERGEN | HBG065757. |
| InParanoid | Q5XF89. |
| KO | K14951. |
| OMA | VVVFTMS. |
| OrthoDB | EOG45HRWM. |
Gene expression databases | |
| Bgee | Q5XF89. |
| Genevestigator | Q5XF89. |
Family and domain databases | |
| Gene3D | 2.70.150.10. 1 hit. 3.40.1110.10. 2 hits. 3.40.50.1000. 2 hits. |
| InterPro | IPR004014. ATPase_P-typ_cation-transptr_N. IPR006544. ATPase_P-typ_Cation_typ_V. IPR023299. ATPase_P-typ_cyto_domN. IPR018303. ATPase_P-typ_P_site. IPR008250. ATPase_P-typ_transduc_dom_A. IPR001757. Cation_transp_P_typ_ATPase. IPR023214. HAD-like_dom. [Graphical view] |
| PANTHER | PTHR24093. PTHR24093. 1 hit. |
| Pfam | PF00690. Cation_ATPase_N. 1 hit. PF00122. E1-E2_ATPase. 1 hit. PF12409. P5-ATPase. 1 hit. [Graphical view] |
| PRINTS | PR00119. CATATPASE. |
| SMART | SM00831. Cation_ATPase_N. 1 hit. [Graphical view] |
| SUPFAM | SSF81660. ATPase_cation_domN. 1 hit. SSF56784. HAD-like_dom. 1 hit. |
| TIGRFAMs | TIGR01494. ATPase_P-type. 2 hits. TIGR01657. P-ATPase-V. 1 hit. |
| PROSITE | PS00154. ATPASE_E1_E2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | ATP13A3. mouse. |
| NextBio | 377055. |
| SOURCE | Search... |
Entry information
| Entry name | AT133_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q5XF89 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
