Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Forkhead box protein P1

Gene

foxp1

Organism
Xenopus laevis (African clawed frog)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Transcriptional repressor.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri208 – 233C2H2-typeSequence analysisAdd BLAST26
DNA bindingi366 – 456Fork-headPROSITE-ProRule annotationAdd BLAST91

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Forkhead box protein P1
Alternative name(s):
XlFoxP1
Gene namesi
Name:foxp1Imported
OrganismiXenopus laevis (African clawed frog)
Taxonomic identifieri8355 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiAmphibiaBatrachiaAnuraPipoideaPipidaeXenopodinaeXenopusXenopus

Organism-specific databases

XenbaseiXB-GENE-961750. foxp1.

Subcellular locationi

GO - Cellular componenti

  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002476511 – 578Forkhead box protein P1Add BLAST578

Expressioni

Tissue specificityi

All isoforms show similar spatial expression. Localized to the animal hemisphere of early cleavage stage embryos. At tailbud stages, expressed in regions of the brain, eye and the splanchnic mesodermal layer of the lateral plate mesoderm surrounding the gut. At stage 35, expressed within the lens of the eye, in distinct regions of the head mesenchyme and in the area anterior to the gut. In the brain the anterior-most expression is restricted to the outer region of the mesencephalon. With ongoing development, additional expression is found in the curling gut.2 Publications

Developmental stagei

Isoform a and isoform b are expressed both maternally and zygotically. Maternal expression disappears before gastrulation and zygotic expression begins after stage 20 and continues throughout embryogenesis. In contrast, isoform c is only detected from stage 30.2 Publications

Interactioni

Subunit structurei

Dimerization is required for DNA-binding (By similarity). Isoform a, but not isoform b, interacts with ctbp1.By similarity1 Publication

GO - Molecular functioni

Structurei

3D structure databases

ProteinModelPortaliQ5W1J5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni250 – 271Leucine-zipperAdd BLAST22
Regioni284 – 288Ctbp1-bindingBy similarity5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi5 – 132Gln-richSequence analysisAdd BLAST128

Domaini

The leucine-zipper is required for dimerization and transcriptional repression.By similarity

Sequence similaritiesi

Contains 1 C2H2-type zinc finger.Sequence analysis
Contains 1 fork-head DNA-binding domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri208 – 233C2H2-typeSequence analysisAdd BLAST26

Keywords - Domaini

Zinc-finger

Phylogenomic databases

HOVERGENiHBG051657.
KOiK09409.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
InterProiIPR001766. Fork_head_dom.
IPR032354. FOXP-CC.
IPR030456. TF_fork_head_CS_2.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF00250. Forkhead. 1 hit.
PF16159. FOXP-CC. 1 hit.
[Graphical view]
PRINTSiPR00053. FORKHEAD.
SMARTiSM00339. FH. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 1 hit.
PROSITEiPS00658. FORK_HEAD_2. 1 hit.
PS50039. FORK_HEAD_3. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform a1 Publication (identifier: Q5W1J5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMTPQVITPQ QMQQILQQQV LTPQQLQVLL QQQQALMLQQ QLQEFYKKQQ
60 70 80 90 100
EQLQLQLLQQ QHAGKQPKEQ QQQQQVATQQ LAFQQQLLQM QQLQQQHLLT
110 120 130 140 150
LQRQGLLSIQ PGQPTLPLQS LAQGMIPAEL QQLWKEVTGS HTADDVVCNN
160 170 180 190 200
HSTLDLSTTC VSSTAQPKTS LLLNSQASTN GQASVLTLKR ESSSHEEYTH
210 220 230 240 250
NHPLYGHGVC KWPGCETICE DFPSFLKHLN SEHALDDRST AQCRVQMQVV
260 270 280 290 300
QQLELQLSKD KERLQAMMSH LHVKSTEPKA SPQPLNLVSS ATLSKTASEA
310 320 330 340 350
SPQSLPHTPT TPTAPLTPIT QGPSVITTTS IHNVGPIRRR YSDKYNIPIS
360 370 380 390 400
SDFAQNQEFY KNAEVRPPFT YASLIRQGIL ESPEKQLTLN EIYNWFTRQF
410 420 430 440 450
AYFRRNAATW KNAVRHNLSL HKCFVRVENV KGAVWTVDEM EFQKRRPQKI
460 470 480 490 500
SGSPTLIKNI QTSHAYCSPL SAALQASMAE NSLPLYTTAS MGNPALNSLA
510 520 530 540 550
NAIREDLNGV MEHTSSNGSD SSPGRSPMQG MHQVHVKEEP LDHDDNDGPL
560 570
SLVTTANHSP DFDRDRDYED DPVNDDME
Length:578
Mass (Da):65,019
Last modified:December 7, 2004 - v1
Checksum:i9EE64499EE99CB43
GO
Isoform b1 Publication (identifier: Q5W1J5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     284-284: P → PQLCTTFGRENGWICYSQQLEEGITGILKG

Show »
Length:607
Mass (Da):68,247
Checksum:i955A5EF3608A4C8B
GO
Isoform c1 Publication (identifier: Q5W1J5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MMQESGTETK...SLQVPVSVAM
     257-263: LSKDKER → VKHSGAS
     264-578: Missing.

Show »
Length:356
Mass (Da):39,815
Checksum:iD4FC81FD78B5B9CB
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti564R → P in CAI96561 (PubMed:16609867).Curated1
Sequence conflicti571D → E in CAI96561 (PubMed:16609867).Curated1
Sequence conflicti575D → E in CAI96561 (PubMed:16609867).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0521221M → MMQESGTETKSNDSVIQNGA GPGNHLLECTLRESRSNGET PLEVGAVELAHLQQQQALQA ARQLLINQQPFSGIKANKRN DKHPSLQVPVSVAM in isoform c. 1 Publication1
Alternative sequenceiVSP_052123257 – 263LSKDKER → VKHSGAS in isoform c. 1 Publication7
Alternative sequenceiVSP_052124264 – 578Missing in isoform c. 1 PublicationAdd BLAST315
Alternative sequenceiVSP_052125284P → PQLCTTFGRENGWICYSQQL EEGITGILKG in isoform b. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ853463 mRNA. Translation: CAH68561.1.
AJ971473 mRNA. Translation: CAI96561.1.
AJ971474 mRNA. Translation: CAI96562.1.
RefSeqiNP_001089002.1. NM_001095533.1.
NP_001090174.1. NM_001096705.1. [Q5W1J5-3]
UniGeneiXl.54021.
Xl.86699.

Genome annotation databases

GeneIDi496386.
779033.
KEGGixla:496386.
xla:779033.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ853463 mRNA. Translation: CAH68561.1.
AJ971473 mRNA. Translation: CAI96561.1.
AJ971474 mRNA. Translation: CAI96562.1.
RefSeqiNP_001089002.1. NM_001095533.1.
NP_001090174.1. NM_001096705.1. [Q5W1J5-3]
UniGeneiXl.54021.
Xl.86699.

3D structure databases

ProteinModelPortaliQ5W1J5.
ModBaseiSearch...
MobiDBiSearch...

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi496386.
779033.
KEGGixla:496386.
xla:779033.

Organism-specific databases

CTDi27086.
779033.
XenbaseiXB-GENE-961750. foxp1.

Phylogenomic databases

HOVERGENiHBG051657.
KOiK09409.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
InterProiIPR001766. Fork_head_dom.
IPR032354. FOXP-CC.
IPR030456. TF_fork_head_CS_2.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF00250. Forkhead. 1 hit.
PF16159. FOXP-CC. 1 hit.
[Graphical view]
PRINTSiPR00053. FORKHEAD.
SMARTiSM00339. FH. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 1 hit.
PROSITEiPS00658. FORK_HEAD_2. 1 hit.
PS50039. FORK_HEAD_3. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFOXP1_XENLA
AccessioniPrimary (citable) accession number: Q5W1J5
Secondary accession number(s): Q4VYS2, Q4VYS3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: December 7, 2004
Last modified: October 5, 2016
This is version 84 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.