Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Palmitoyltransferase ZDHHC20

Gene

ZDHHC20

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalyzes palmitoylation of Cys residues on target proteins (PubMed:27153536, PubMed:29326245). Catalyzes palmitoylation of Cys residues in the cytoplasmic C-terminus of EGFR, and modulates the duration of EGFR signaling by modulating palmitoylation-dependent EGFR internalization and degradation (PubMed:27153536). Has a preference for acyl-CoA with C16 fatty acid chains (PubMed:29326245). Can also utilize acyl-CoA with C14 and C18 fatty acid chains (PubMed:29326245).2 Publications

Catalytic activityi

Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei29Important for selectivity toward medium-length fatty acids1 Publication1
Metal bindingi128Zinc 1Combined sources1 Publication1
Metal bindingi131Zinc 1Combined sources1 Publication1
Binding sitei135Substrate1 Publication1
Metal bindingi141Zinc 1Combined sources1 Publication1
Metal bindingi142Zinc 2Combined sources1 Publication1
Metal bindingi145Zinc 2Combined sources1 Publication1
Metal bindingi148Zinc 1Combined sources1 Publication1
Metal bindingi155Zinc 2Combined sources1 Publication1
Active sitei156S-palmitoyl cysteine intermediate1 Publication1
Metal bindingi162Zinc 2Combined sources1 Publication1
Sitei181Important for selectivity toward medium-length fatty acids1 Publication1

GO - Molecular functioni

  • palmitoyltransferase activity Source: UniProtKB
  • protein-cysteine S-palmitoyltransferase activity Source: UniProtKB
  • zinc ion binding Source: UniProtKB

GO - Biological processi

  • peptidyl-L-cysteine S-palmitoylation Source: UniProtKB
  • protein palmitoylation Source: UniProtKB

Keywordsi

Molecular functionAcyltransferase, Transferase
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Palmitoyltransferase ZDHHC20 (EC:2.3.1.2252 Publications)
Alternative name(s):
Zinc finger DHHC domain-containing protein 20
Short name:
DHHC-20
Gene namesi
Name:ZDHHC20
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

EuPathDBiHostDB:ENSG00000180776.15
HGNCiHGNC:20749 ZDHHC20
neXtProtiNX_Q5W0Z9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 14Lumenal1 PublicationAdd BLAST14
Transmembranei15 – 35Helical1 PublicationAdd BLAST21
Topological domaini36 – 53Cytoplasmic1 PublicationAdd BLAST18
Transmembranei54 – 74Helical1 PublicationAdd BLAST21
Topological domaini75 – 169Lumenal1 PublicationAdd BLAST95
Transmembranei170 – 190Helical1 PublicationAdd BLAST21
Topological domaini191 – 207Cytoplasmic1 PublicationAdd BLAST17
Transmembranei208 – 231Helical1 PublicationAdd BLAST24
Topological domaini232 – 365Lumenal1 PublicationAdd BLAST134

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi22I → W: Strongly reduced catalytic activity. 1 Publication1
Mutagenesisi29S → F: Strongly reduced catalytic activity. Enhances activity with acyl-CoA with C12 and C14 fatty acid chains. 1 Publication1
Mutagenesisi153D → A: Loss of catalytic activity. 1 Publication1
Mutagenesisi154H → A: Loss of catalytic activity. 1 Publication1
Mutagenesisi156C → S: Loss of catalytic activity. 1 Publication1
Mutagenesisi158W → A: Strongly reduced catalytic activity. 1 Publication1
Mutagenesisi171F → A: Loss of catalytic activity. 1 Publication1
Mutagenesisi174F → A: Strongly reduced catalytic activity. 1 Publication1
Mutagenesisi181Y → A: Moderately reduced catalytic activity. Enhances activity with acyl-CoA with C18 and C20 fatty acid chains. 1 Publication1
Mutagenesisi227L → W: Loss of catalytic activity. 1 Publication1
Mutagenesisi240 – 241TT → AA: Loss of catalytic activity. 1 Publication2
Mutagenesisi243E → A: Mildly reduced catalytic activity. 1 Publication1
Mutagenesisi266N → A: Strongly reduced catalytic activity. 1 Publication1
Mutagenesisi267Missing : Loss of catalytic activity. 1 Publication1
Mutagenesisi271F → A: Mildly reduced catalytic activity. 1 Publication1

Organism-specific databases

OpenTargetsiENSG00000180776
PharmGKBiPA134880838

Polymorphism and mutation databases

BioMutaiZDHHC20
DMDMi74748004

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002129061 – 365Palmitoyltransferase ZDHHC20Add BLAST365

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei305PhosphoserineCombined sources1
Modified residuei330PhosphoserineCombined sources1
Modified residuei339PhosphoserineCombined sources1

Post-translational modificationi

Autopalmitoylated (in vitro).1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

EPDiQ5W0Z9
MaxQBiQ5W0Z9
PaxDbiQ5W0Z9
PeptideAtlasiQ5W0Z9
PRIDEiQ5W0Z9
ProteomicsDBi65788
65789 [Q5W0Z9-2]
65790 [Q5W0Z9-3]

PTM databases

iPTMnetiQ5W0Z9
PhosphoSitePlusiQ5W0Z9
SwissPalmiQ5W0Z9

Expressioni

Gene expression databases

BgeeiENSG00000180776
CleanExiHS_ZDHHC20
ExpressionAtlasiQ5W0Z9 baseline and differential
GenevisibleiQ5W0Z9 HS

Organism-specific databases

HPAiHPA014483
HPA014702

Interactioni

Protein-protein interaction databases

BioGridi128991, 3 interactors
IntActiQ5W0Z9, 2 interactors
STRINGi9606.ENSP00000371905

Structurei

Secondary structure

1365
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi7 – 14Combined sources8
Helixi17 – 34Combined sources18
Helixi35 – 42Combined sources8
Turni43 – 46Combined sources4
Helixi48 – 74Combined sources27
Helixi82 – 84Combined sources3
Helixi90 – 96Combined sources7
Helixi100 – 111Combined sources12
Turni112 – 115Combined sources4
Turni129 – 132Combined sources4
Beta strandi140 – 142Combined sources3
Turni143 – 146Combined sources4
Beta strandi147 – 149Combined sources3
Beta strandi154 – 156Combined sources3
Helixi157 – 159Combined sources3
Beta strandi161 – 164Combined sources4
Turni165 – 167Combined sources3
Helixi168 – 197Combined sources30
Helixi204 – 237Combined sources34
Helixi241 – 245Combined sources5
Turni256 – 259Combined sources4
Helixi263 – 271Combined sources9
Helixi275 – 277Combined sources3
Beta strandi280 – 282Combined sources3
Beta strandi295 – 297Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6BMLX-ray2.95A/B5-299[»]
6BMMX-ray2.35A/B7-299[»]
6BMNX-ray2.25A/B5-299[»]
ProteinModelPortaliQ5W0Z9
SMRiQ5W0Z9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini126 – 176DHHCPROSITE-ProRule annotationAdd BLAST51

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni140 – 143Substrate binding1 Publication4

Domaini

The DHHC domain is required for palmitoyltransferase activity.1 Publication

Sequence similaritiesi

Belongs to the DHHC palmitoyltransferase family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1315 Eukaryota
COG5273 LUCA
GeneTreeiENSGT00880000137864
HOGENOMiHOG000234777
HOVERGENiHBG055108
InParanoidiQ5W0Z9
KOiK20028
OMAiSRTIRYC
OrthoDBiEOG091G0AXR
PhylomeDBiQ5W0Z9
TreeFamiTF316044

Family and domain databases

InterProiView protein in InterPro
IPR001594 Palmitoyltrfase_DHHC
PfamiView protein in Pfam
PF01529 DHHC, 1 hit
PROSITEiView protein in PROSITE
PS50216 DHHC, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5W0Z9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPWTLWRCC QRVVGWVPVL FITFVVVWSY YAYVVELCVF TIFGNEENGK
60 70 80 90 100
TVVYLVAFHL FFVMFVWSYW MTIFTSPASP SKEFYLSNSE KERYEKEFSQ
110 120 130 140 150
ERQQEILRRA ARALPIYTTS ASKTIRYCEK CQLIKPDRAH HCSACDSCIL
160 170 180 190 200
KMDHHCPWVN NCVGFSNYKF FLLFLLYSLL YCLFVAATVL EYFIKFWTNE
210 220 230 240 250
LTDTRAKFHV LFLFFVSAMF FISVLSLFSY HCWLVGKNRT TIESFRAPTF
260 270 280 290 300
SYGPDGNGFS LGCSKNWRQV FGDEKKYWLL PIFSSLGDGC SFPTRLVGMD
310 320 330 340 350
PEQASVTNQN EYARSSGSNQ PFPIKPLSES KNRLLDSESQ WLENGAEEGI
360
VKSGTNNHVT VAIEN
Length:365
Mass (Da):42,278
Last modified:December 7, 2004 - v1
Checksum:i179D8882138E4F53
GO
Isoform 2 (identifier: Q5W0Z9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     124-130: TIRYCEK → SLMQSTK
     131-365: Missing.

Note: No experimental confirmation available.
Show »
Length:130
Mass (Da):15,419
Checksum:iEF3F16905EED1A5D
GO
Isoform 3 (identifier: Q5W0Z9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     315-315: Missing.
     355-365: TNNHVTVAIEN → V

Show »
Length:354
Mass (Da):41,096
Checksum:i83CC11ECA4D38A17
GO
Isoform 4 (identifier: Q5W0Z9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     315-365: SSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIEN → RSKLQR

Note: No experimental confirmation available.
Show »
Length:320
Mass (Da):37,555
Checksum:i043D138E64899CB0
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_016276124 – 130TIRYCEK → SLMQSTK in isoform 2. 1 Publication7
Alternative sequenceiVSP_016277131 – 365Missing in isoform 2. 1 PublicationAdd BLAST235
Alternative sequenceiVSP_056002315 – 365SSGSN…VAIEN → RSKLQR in isoform 4. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_040481315Missing in isoform 3. 1 Publication1
Alternative sequenceiVSP_040482355 – 365TNNHVTVAIEN → V in isoform 3. 1 PublicationAdd BLAST11

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136219 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08309.1
BC034944 mRNA Translation: AAH34944.1
BC050367 mRNA Translation: AAH50367.2
BC067898 mRNA Translation: AAH67898.1
BC110517 mRNA Translation: AAI10518.1
CCDSiCCDS45017.1 [Q5W0Z9-3]
CCDS81758.1 [Q5W0Z9-1]
RefSeqiNP_001273567.1, NM_001286638.1
NP_001316988.1, NM_001330059.1 [Q5W0Z9-1]
NP_694983.2, NM_153251.3 [Q5W0Z9-3]
UniGeneiHs.564611

Genome annotation databases

EnsembliENST00000320220; ENSP00000313583; ENSG00000180776 [Q5W0Z9-4]
ENST00000382466; ENSP00000371905; ENSG00000180776 [Q5W0Z9-3]
ENST00000400590; ENSP00000383433; ENSG00000180776 [Q5W0Z9-1]
ENST00000415724; ENSP00000401232; ENSG00000180776 [Q5W0Z9-1]
GeneIDi253832
KEGGihsa:253832
UCSCiuc001uoa.4 human [Q5W0Z9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiZDH20_HUMAN
AccessioniPrimary (citable) accession number: Q5W0Z9
Secondary accession number(s): A8MTV9
, C9JG20, I6L9D4, Q2TB82, Q6NVU8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: December 7, 2004
Last modified: June 20, 2018
This is version 121 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health