Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable palmitoyltransferase ZDHHC20

Gene

ZDHHC20

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Catalytic activityi

Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri126 – 17651DHHC-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

  • protein palmitoylation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Acyltransferase, Transferase

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Probable palmitoyltransferase ZDHHC20 (EC:2.3.1.225)
Alternative name(s):
Zinc finger DHHC domain-containing protein 20
Short name:
DHHC-20
Gene namesi
Name:ZDHHC20
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

HGNCiHGNC:20749. ZDHHC20.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei13 – 3321HelicalSequence analysisAdd
BLAST
Transmembranei54 – 7421HelicalSequence analysisAdd
BLAST
Transmembranei170 – 19021HelicalSequence analysisAdd
BLAST
Transmembranei208 – 22821HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

  • integral component of membrane Source: UniProtKB-KW
  • membrane Source: UniProtKB
  • plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134880838.

Polymorphism and mutation databases

BioMutaiZDHHC20.
DMDMi74748004.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 365365Probable palmitoyltransferase ZDHHC20PRO_0000212906Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei339 – 3391PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ5W0Z9.
MaxQBiQ5W0Z9.
PaxDbiQ5W0Z9.
PRIDEiQ5W0Z9.

PTM databases

iPTMnetiQ5W0Z9.
PhosphoSiteiQ5W0Z9.
SwissPalmiQ5W0Z9.

Expressioni

Gene expression databases

BgeeiQ5W0Z9.
CleanExiHS_ZDHHC20.
ExpressionAtlasiQ5W0Z9. baseline and differential.
GenevisibleiQ5W0Z9. HS.

Organism-specific databases

HPAiHPA014483.
HPA014702.

Interactioni

Protein-protein interaction databases

BioGridi128991. 2 interactions.
IntActiQ5W0Z9. 1 interaction.
STRINGi9606.ENSP00000371905.

Structurei

3D structure databases

ProteinModelPortaliQ5W0Z9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domaini

The DHHC domain is required for palmitoyltransferase activity.By similarity

Sequence similaritiesi

Belongs to the DHHC palmitoyltransferase family.Curated
Contains 1 DHHC-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri126 – 17651DHHC-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Transmembrane, Transmembrane helix, Zinc-finger

Phylogenomic databases

eggNOGiKOG1315. Eukaryota.
COG5273. LUCA.
GeneTreeiENSGT00840000129766.
HOGENOMiHOG000234777.
HOVERGENiHBG055108.
InParanoidiQ5W0Z9.
KOiK20028.
OMAiRCCQRIV.
OrthoDBiEOG71ZP21.
PhylomeDBiQ5W0Z9.
TreeFamiTF316044.

Family and domain databases

InterProiIPR001594. Znf_DHHC_palmitoyltrfase.
[Graphical view]
PfamiPF01529. zf-DHHC. 1 hit.
[Graphical view]
PROSITEiPS50216. ZF_DHHC. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5W0Z9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPWTLWRCC QRVVGWVPVL FITFVVVWSY YAYVVELCVF TIFGNEENGK
60 70 80 90 100
TVVYLVAFHL FFVMFVWSYW MTIFTSPASP SKEFYLSNSE KERYEKEFSQ
110 120 130 140 150
ERQQEILRRA ARALPIYTTS ASKTIRYCEK CQLIKPDRAH HCSACDSCIL
160 170 180 190 200
KMDHHCPWVN NCVGFSNYKF FLLFLLYSLL YCLFVAATVL EYFIKFWTNE
210 220 230 240 250
LTDTRAKFHV LFLFFVSAMF FISVLSLFSY HCWLVGKNRT TIESFRAPTF
260 270 280 290 300
SYGPDGNGFS LGCSKNWRQV FGDEKKYWLL PIFSSLGDGC SFPTRLVGMD
310 320 330 340 350
PEQASVTNQN EYARSSGSNQ PFPIKPLSES KNRLLDSESQ WLENGAEEGI
360
VKSGTNNHVT VAIEN
Length:365
Mass (Da):42,278
Last modified:December 7, 2004 - v1
Checksum:i179D8882138E4F53
GO
Isoform 2 (identifier: Q5W0Z9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     124-130: TIRYCEK → SLMQSTK
     131-365: Missing.

Note: No experimental confirmation available.
Show »
Length:130
Mass (Da):15,419
Checksum:iEF3F16905EED1A5D
GO
Isoform 3 (identifier: Q5W0Z9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     315-315: Missing.
     355-365: TNNHVTVAIEN → V

Show »
Length:354
Mass (Da):41,096
Checksum:i83CC11ECA4D38A17
GO
Isoform 4 (identifier: Q5W0Z9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     315-365: SSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIEN → RSKLQR

Note: No experimental confirmation available.
Show »
Length:320
Mass (Da):37,555
Checksum:i043D138E64899CB0
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei124 – 1307TIRYCEK → SLMQSTK in isoform 2. 1 PublicationVSP_016276
Alternative sequencei131 – 365235Missing in isoform 2. 1 PublicationVSP_016277Add
BLAST
Alternative sequencei315 – 36551SSGSN…VAIEN → RSKLQR in isoform 4. 1 PublicationVSP_056002Add
BLAST
Alternative sequencei315 – 3151Missing in isoform 3. 1 PublicationVSP_040481
Alternative sequencei355 – 36511TNNHVTVAIEN → V in isoform 3. 1 PublicationVSP_040482Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136219 Genomic DNA. Translation: CAH70596.1.
CH471075 Genomic DNA. Translation: EAX08309.1.
BC034944 mRNA. Translation: AAH34944.1.
BC050367 mRNA. Translation: AAH50367.2.
BC067898 mRNA. Translation: AAH67898.1.
BC110517 mRNA. Translation: AAI10518.1.
CCDSiCCDS45017.1. [Q5W0Z9-3]
RefSeqiNP_001273567.1. NM_001286638.1.
NP_694983.2. NM_153251.3. [Q5W0Z9-3]
XP_006719858.1. XM_006719795.1. [Q5W0Z9-1]
UniGeneiHs.564611.

Genome annotation databases

EnsembliENST00000320220; ENSP00000313583; ENSG00000180776. [Q5W0Z9-4]
ENST00000382466; ENSP00000371905; ENSG00000180776. [Q5W0Z9-3]
ENST00000400590; ENSP00000383433; ENSG00000180776. [Q5W0Z9-1]
ENST00000415724; ENSP00000401232; ENSG00000180776. [Q5W0Z9-1]
GeneIDi253832.
KEGGihsa:253832.
UCSCiuc001uoa.4. human. [Q5W0Z9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136219 Genomic DNA. Translation: CAH70596.1.
CH471075 Genomic DNA. Translation: EAX08309.1.
BC034944 mRNA. Translation: AAH34944.1.
BC050367 mRNA. Translation: AAH50367.2.
BC067898 mRNA. Translation: AAH67898.1.
BC110517 mRNA. Translation: AAI10518.1.
CCDSiCCDS45017.1. [Q5W0Z9-3]
RefSeqiNP_001273567.1. NM_001286638.1.
NP_694983.2. NM_153251.3. [Q5W0Z9-3]
XP_006719858.1. XM_006719795.1. [Q5W0Z9-1]
UniGeneiHs.564611.

3D structure databases

ProteinModelPortaliQ5W0Z9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128991. 2 interactions.
IntActiQ5W0Z9. 1 interaction.
STRINGi9606.ENSP00000371905.

PTM databases

iPTMnetiQ5W0Z9.
PhosphoSiteiQ5W0Z9.
SwissPalmiQ5W0Z9.

Polymorphism and mutation databases

BioMutaiZDHHC20.
DMDMi74748004.

Proteomic databases

EPDiQ5W0Z9.
MaxQBiQ5W0Z9.
PaxDbiQ5W0Z9.
PRIDEiQ5W0Z9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000320220; ENSP00000313583; ENSG00000180776. [Q5W0Z9-4]
ENST00000382466; ENSP00000371905; ENSG00000180776. [Q5W0Z9-3]
ENST00000400590; ENSP00000383433; ENSG00000180776. [Q5W0Z9-1]
ENST00000415724; ENSP00000401232; ENSG00000180776. [Q5W0Z9-1]
GeneIDi253832.
KEGGihsa:253832.
UCSCiuc001uoa.4. human. [Q5W0Z9-1]

Organism-specific databases

CTDi253832.
GeneCardsiZDHHC20.
HGNCiHGNC:20749. ZDHHC20.
HPAiHPA014483.
HPA014702.
neXtProtiNX_Q5W0Z9.
PharmGKBiPA134880838.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1315. Eukaryota.
COG5273. LUCA.
GeneTreeiENSGT00840000129766.
HOGENOMiHOG000234777.
HOVERGENiHBG055108.
InParanoidiQ5W0Z9.
KOiK20028.
OMAiRCCQRIV.
OrthoDBiEOG71ZP21.
PhylomeDBiQ5W0Z9.
TreeFamiTF316044.

Miscellaneous databases

ChiTaRSiZDHHC20. human.
GenomeRNAii253832.
PROiQ5W0Z9.

Gene expression databases

BgeeiQ5W0Z9.
CleanExiHS_ZDHHC20.
ExpressionAtlasiQ5W0Z9. baseline and differential.
GenevisibleiQ5W0Z9. HS.

Family and domain databases

InterProiIPR001594. Znf_DHHC_palmitoyltrfase.
[Graphical view]
PfamiPF01529. zf-DHHC. 1 hit.
[Graphical view]
PROSITEiPS50216. ZF_DHHC. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The DNA sequence and analysis of human chromosome 13."
    Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
    Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
    Tissue: Ovary and Testis.
  4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-339, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic kidney.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiZDH20_HUMAN
AccessioniPrimary (citable) accession number: Q5W0Z9
Secondary accession number(s): A8MTV9
, C9JG20, I6L9D4, Q2TB82, Q6NVU8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: December 7, 2004
Last modified: June 8, 2016
This is version 104 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.