SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5VZY2

- PPC1A_HUMAN

UniProt

Q5VZY2 - PPC1A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Phosphatidate phosphatase PPAPDC1A
Gene
PPAPDC1A, DPPL2, PPAPDC1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Displays magnesium-independent phosphatidate phosphatase activity in vitro. Catalyzes the conversion of phosphatidic acid to diacylglycerol.1 Publication

Catalytic activityi

A 1,2-diacylglycerol 3-phosphate + H2O = a 1,2-diacyl-sn-glycerol + phosphate.1 Publication

Enzyme regulationi

Inhibited by N-ethylmaleimide.1 Publication

Kineticsi

  1. KM=104 µM for diacylglycerol pyrophosphate1 Publication
  2. KM=506 µM for phosphatidate
  3. KM=580 µM for lysophosphatidate

GO - Molecular functioni

  1. phosphatidate phosphatase activity Source: UniProtKB
Complete GO annotation...

GO - Biological processi

  1. Fc-gamma receptor signaling pathway involved in phagocytosis Source: Reactome
  2. innate immune response Source: Reactome
  3. phospholipid dephosphorylation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Enzyme and pathway databases

ReactomeiREACT_160158. Role of phospholipids in phagocytosis.

Names & Taxonomyi

Protein namesi
Recommended name:
Phosphatidate phosphatase PPAPDC1A (EC:3.1.3.4)
Alternative name(s):
Phosphatidic acid phosphatase type 2 domain-containing protein 1A
Gene namesi
Synonyms:DPPL2, PPAPDC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:23531. PPAPDC1A.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei4 – 2421Helical; Reviewed prediction
Add
BLAST
Transmembranei49 – 6921Helical; Reviewed prediction
Add
BLAST
Transmembranei84 – 10421Helical; Reviewed prediction
Add
BLAST
Transmembranei142 – 16221Helical; Reviewed prediction
Add
BLAST
Transmembranei179 – 19921Helical; Reviewed prediction
Add
BLAST
Transmembranei202 – 22221Helical; Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi109 – 1091R → A: Loss of phosphatase activity; when associated with A-146 and with A-202. 1 Publication
Mutagenesisi146 – 1461H → A: Loss of phosphatase activity; when associated with A-109 and with A-202. 1 Publication
Mutagenesisi202 – 2021H → A: Loss of phosphatase activity; when associated with A-109 and with A-146. 1 Publication

Organism-specific databases

PharmGKBiPA134907381.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 271271Phosphatidate phosphatase PPAPDC1A
PRO_0000286943Add
BLAST

Proteomic databases

PaxDbiQ5VZY2.
PRIDEiQ5VZY2.

PTM databases

PhosphoSiteiQ5VZY2.

Expressioni

Tissue specificityi

Expressed mainly to the brain, kidney and testis, and to a lesser extent the bone marrow, thymus, prostate, liver and uterus.1 Publication

Gene expression databases

ArrayExpressiQ5VZY2.
BgeeiQ5VZY2.
CleanExiHS_PPAPDC1A.
GenevestigatoriQ5VZY2.

Organism-specific databases

HPAiHPA045188.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000381302.

Structurei

3D structure databases

ProteinModelPortaliQ5VZY2.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni102 – 1109Phosphatase sequence motif I
Regioni143 – 1464Phosphatase sequence motif II
Regioni195 – 20511Phosphatase sequence motif III
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0671.
HOGENOMiHOG000215098.
HOVERGENiHBG056764.
InParanoidiQ5VZY2.
OMAiNTACHKS.
OrthoDBiEOG79CZ0D.
PhylomeDBiQ5VZY2.
TreeFamiTF323722.

Family and domain databases

Gene3Di1.20.144.10. 1 hit.
InterProiIPR000326. P_Acid_Pase_2/haloperoxidase.
IPR028668. PPAPDC1A/PPAPDC1B.
[Graphical view]
PANTHERiPTHR10165:SF90. PTHR10165:SF90. 1 hit.
PfamiPF01569. PAP2. 1 hit.
[Graphical view]
SMARTiSM00014. acidPPc. 1 hit.
[Graphical view]
SUPFAMiSSF48317. SSF48317. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5VZY2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MRELAIEIGV RALLFGVFVF TEFLDPFQRV IQPEEIWLYK NPLVQSDNIP    50
TRLMFAISFL TPLAVICVVK IIRRTDKTEI KEAFLAVSLA LALNGVCTNT 100
IKLIVGRPRP DFFYRCFPDG VMNSEMHCTG DPDLVSEGRK SFPSIHSSFA 150
FSGLGFTTFY LAGKLHCFTE SGRGKSWRLC AAILPLYCAM MIALSRMCDY 200
KHHWQDSFVG GVIGLIFAYI CYRQHYPPLA NTACHKPYVS LRVPASLKKE 250
ERPTADSAPS LPLEGITEGP V 271
Length:271
Mass (Da):30,395
Last modified:May 15, 2007 - v2
Checksum:iC534549E44DDB9A1
GO
Isoform 2 (identifier: Q5VZY2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     86-149: AVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDGVMNSEMHCTGDPDLVSEGRKSFPSIHSSF → V

Note: No experimental confirmation available.

Show »
Length:208
Mass (Da):23,509
Checksum:i9C4052029FE63D0F
GO
Isoform 3 (identifier: Q5VZY2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-189: Missing.

Note: No experimental confirmation available.

Show »
Length:82
Mass (Da):9,175
Checksum:iA228474E1B007DBA
GO
Isoform 4 (identifier: Q5VZY2-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     56-96: AISFLTPLAV...VSLALALNGV → IPLWVESSAS...PTLVCESQPH
     97-271: Missing.

Note: No experimental confirmation available.

Show »
Length:96
Mass (Da):11,089
Checksum:iDE39DF5B00D26259
GO

Sequence cautioni

The sequence CAH70333.1 differs from that shown. Reason: Erroneous gene model prediction.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 189189Missing in isoform 3.
VSP_025237Add
BLAST
Alternative sequencei56 – 9641AISFL…ALNGV → IPLWVESSASFLHTFATDST ILLWPTQLAINPTLVCESQP H in isoform 4.
VSP_025239Add
BLAST
Alternative sequencei86 – 14964AVSLA…IHSSF → V in isoform 2.
VSP_025238Add
BLAST
Alternative sequencei97 – 271175Missing in isoform 4.
VSP_025240Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
BD418666 mRNA. No translation available.
AL157782, AC073587, AC023282 Genomic DNA. Translation: CAH70332.1. Different termination.
AL157782, AC023282, AC073587 Genomic DNA. Translation: CAH70333.1. Sequence problems.
BC101267 mRNA. Translation: AAI01268.1.
BC101268 mRNA. Translation: AAI01269.1.
BC101269 mRNA. Translation: AAI01270.1.
BC122535 mRNA. Translation: AAI22536.1.
BC132787 mRNA. Translation: AAI32788.1.
CCDSiCCDS41573.1. [Q5VZY2-1]
RefSeqiNP_001025230.1. NM_001030059.1. [Q5VZY2-1]
UniGeneiHs.40479.

Genome annotation databases

EnsembliENST00000398248; ENSP00000381300; ENSG00000203805. [Q5VZY2-4]
ENST00000398250; ENSP00000381302; ENSG00000203805. [Q5VZY2-1]
ENST00000439221; ENSP00000403508; ENSG00000203805. [Q5VZY2-2]
GeneIDi196051.
KEGGihsa:196051.
UCSCiuc001lev.1. human. [Q5VZY2-1]
uc001lew.1. human. [Q5VZY2-4]
uc009xzl.1. human. [Q5VZY2-2]

Polymorphism databases

DMDMi147721098.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
BD418666 mRNA. No translation available.
AL157782 , AC073587 , AC023282 Genomic DNA. Translation: CAH70332.1 . Different termination.
AL157782 , AC023282 , AC073587 Genomic DNA. Translation: CAH70333.1 . Sequence problems.
BC101267 mRNA. Translation: AAI01268.1 .
BC101268 mRNA. Translation: AAI01269.1 .
BC101269 mRNA. Translation: AAI01270.1 .
BC122535 mRNA. Translation: AAI22536.1 .
BC132787 mRNA. Translation: AAI32788.1 .
CCDSi CCDS41573.1. [Q5VZY2-1 ]
RefSeqi NP_001025230.1. NM_001030059.1. [Q5VZY2-1 ]
UniGenei Hs.40479.

3D structure databases

ProteinModelPortali Q5VZY2.
ModBasei Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000381302.

PTM databases

PhosphoSitei Q5VZY2.

Polymorphism databases

DMDMi 147721098.

Proteomic databases

PaxDbi Q5VZY2.
PRIDEi Q5VZY2.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000398248 ; ENSP00000381300 ; ENSG00000203805 . [Q5VZY2-4 ]
ENST00000398250 ; ENSP00000381302 ; ENSG00000203805 . [Q5VZY2-1 ]
ENST00000439221 ; ENSP00000403508 ; ENSG00000203805 . [Q5VZY2-2 ]
GeneIDi 196051.
KEGGi hsa:196051.
UCSCi uc001lev.1. human. [Q5VZY2-1 ]
uc001lew.1. human. [Q5VZY2-4 ]
uc009xzl.1. human. [Q5VZY2-2 ]

Organism-specific databases

CTDi 196051.
GeneCardsi GC10P122207.
HGNCi HGNC:23531. PPAPDC1A.
HPAi HPA045188.
neXtProti NX_Q5VZY2.
PharmGKBi PA134907381.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0671.
HOGENOMi HOG000215098.
HOVERGENi HBG056764.
InParanoidi Q5VZY2.
OMAi NTACHKS.
OrthoDBi EOG79CZ0D.
PhylomeDBi Q5VZY2.
TreeFami TF323722.

Enzyme and pathway databases

Reactomei REACT_160158. Role of phospholipids in phagocytosis.

Miscellaneous databases

GeneWikii PPAPDC1A.
GenomeRNAii 196051.
NextBioi 89410.
PROi Q5VZY2.

Gene expression databases

ArrayExpressi Q5VZY2.
Bgeei Q5VZY2.
CleanExi HS_PPAPDC1A.
Genevestigatori Q5VZY2.

Family and domain databases

Gene3Di 1.20.144.10. 1 hit.
InterProi IPR000326. P_Acid_Pase_2/haloperoxidase.
IPR028668. PPAPDC1A/PPAPDC1B.
[Graphical view ]
PANTHERi PTHR10165:SF90. PTHR10165:SF90. 1 hit.
Pfami PF01569. PAP2. 1 hit.
[Graphical view ]
SMARTi SM00014. acidPPc. 1 hit.
[Graphical view ]
SUPFAMi SSF48317. SSF48317. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of DPPL1 and DPPL2, representatives of a novel type of mammalian phosphatidate phosphatase."
    Takeuchi M., Harigai M., Momohara S., Ball E., Abe J., Furuichi K., Kamatani N.
    Gene 399:174-180(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], FUNCTION, TISSUE SPECIFICITY, ENZYME REGULATION, CATALYTIC ACTIVITY, REGION, MUTAGENESIS OF ARG-109; HIS-146 AND HIS-202, BIOPHYSICOCHEMICAL PROPERTIES.
  2. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
    Tissue: Brain.

Entry informationi

Entry nameiPPC1A_HUMAN
AccessioniPrimary (citable) accession number: Q5VZY2
Secondary accession number(s): A2RU82
, Q08EQ2, Q0IIP2, Q495B4, Q5VZY1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: May 15, 2007
Last modified: September 3, 2014
This is version 80 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi