Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phospholipid phosphatase 4

Gene

PLPP4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Displays magnesium-independent phosphatidate phosphatase activity in vitro. Catalyzes the conversion of phosphatidic acid to diacylglycerol.1 Publication

Catalytic activityi

A 1,2-diacylglycerol 3-phosphate + H2O = a 1,2-diacyl-sn-glycerol + phosphate.1 Publication

Enzyme regulationi

Inhibited by N-ethylmaleimide.1 Publication

Kineticsi

  1. KM=104 µM for diacylglycerol pyrophosphate1 Publication
  2. KM=506 µM for phosphatidate1 Publication
  3. KM=580 µM for lysophosphatidate1 Publication

    GO - Molecular functioni

    • phosphatidate phosphatase activity Source: UniProtKB

    GO - Biological processi

    Complete GO annotation...

    Keywords - Molecular functioni

    Hydrolase

    Enzyme and pathway databases

    BRENDAi3.1.3.4. 2681.
    3.1.3.81. 2681.
    ReactomeiR-HSA-2029485. Role of phospholipids in phagocytosis.

    Chemistry

    SwissLipidsiSLP:000000605.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Phospholipid phosphatase 4Imported (EC:3.1.3.4)
    Alternative name(s):
    Phosphatidic acid phosphatase type 2 domain-containing protein 1A
    Gene namesi
    Name:PLPP4Imported
    Synonyms:DPPL2, PPAPDC1, PPAPDC1A
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    Proteomesi
    • UP000005640 Componenti: Chromosome 10

    Organism-specific databases

    HGNCiHGNC:23531. PLPP4.

    Subcellular locationi

    Topology

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei4 – 2421HelicalSequence analysisAdd
    BLAST
    Transmembranei49 – 6921HelicalSequence analysisAdd
    BLAST
    Transmembranei84 – 10421HelicalSequence analysisAdd
    BLAST
    Transmembranei142 – 16221HelicalSequence analysisAdd
    BLAST
    Transmembranei179 – 19921HelicalSequence analysisAdd
    BLAST
    Transmembranei202 – 22221HelicalSequence analysisAdd
    BLAST

    GO - Cellular componenti

    Complete GO annotation...

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi109 – 1091R → A: Loss of phosphatase activity; when associated with A-146 and with A-202. 1 Publication
    Mutagenesisi146 – 1461H → A: Loss of phosphatase activity; when associated with A-109 and with A-202. 1 Publication
    Mutagenesisi202 – 2021H → A: Loss of phosphatase activity; when associated with A-109 and with A-146. 1 Publication

    Organism-specific databases

    PharmGKBiPA134907381.

    Polymorphism and mutation databases

    BioMutaiPPAPDC1A.
    DMDMi147721098.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 271271Phospholipid phosphatase 4PRO_0000286943Add
    BLAST

    Proteomic databases

    PaxDbiQ5VZY2.
    PRIDEiQ5VZY2.

    PTM databases

    DEPODiQ5VZY2.
    iPTMnetiQ5VZY2.
    PhosphoSiteiQ5VZY2.

    Expressioni

    Tissue specificityi

    Expressed mainly to the brain, kidney and testis, and to a lesser extent the bone marrow, thymus, prostate, liver and uterus.1 Publication

    Gene expression databases

    BgeeiENSG00000203805.
    CleanExiHS_PPAPDC1A.
    ExpressionAtlasiQ5VZY2. baseline and differential.
    GenevisibleiQ5VZY2. HS.

    Organism-specific databases

    HPAiHPA045188.

    Interactioni

    Protein-protein interaction databases

    BioGridi128189. 1 interaction.
    STRINGi9606.ENSP00000381302.

    Structurei

    3D structure databases

    ProteinModelPortaliQ5VZY2.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni102 – 1109Phosphatase sequence motif I
    Regioni143 – 1464Phosphatase sequence motif II
    Regioni195 – 20511Phosphatase sequence motif IIIAdd
    BLAST

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiKOG3030. Eukaryota.
    COG0671. LUCA.
    GeneTreeiENSGT00510000046723.
    HOGENOMiHOG000215098.
    HOVERGENiHBG056764.
    InParanoidiQ5VZY2.
    OMAiKEEMPTA.
    OrthoDBiEOG091G0O0I.
    PhylomeDBiQ5VZY2.
    TreeFamiTF323722.

    Family and domain databases

    Gene3Di1.20.144.10. 1 hit.
    InterProiIPR000326. P_Acid_Pase_2/haloperoxidase.
    IPR028668. PLPP4.
    [Graphical view]
    PANTHERiPTHR10165:SF90. PTHR10165:SF90. 1 hit.
    PfamiPF01569. PAP2. 1 hit.
    [Graphical view]
    SMARTiSM00014. acidPPc. 1 hit.
    [Graphical view]
    SUPFAMiSSF48317. SSF48317. 1 hit.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

    Isoform 1 (identifier: Q5VZY2-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

            10         20         30         40         50
    MRELAIEIGV RALLFGVFVF TEFLDPFQRV IQPEEIWLYK NPLVQSDNIP
    60 70 80 90 100
    TRLMFAISFL TPLAVICVVK IIRRTDKTEI KEAFLAVSLA LALNGVCTNT
    110 120 130 140 150
    IKLIVGRPRP DFFYRCFPDG VMNSEMHCTG DPDLVSEGRK SFPSIHSSFA
    160 170 180 190 200
    FSGLGFTTFY LAGKLHCFTE SGRGKSWRLC AAILPLYCAM MIALSRMCDY
    210 220 230 240 250
    KHHWQDSFVG GVIGLIFAYI CYRQHYPPLA NTACHKPYVS LRVPASLKKE
    260 270
    ERPTADSAPS LPLEGITEGP V
    Length:271
    Mass (Da):30,395
    Last modified:May 15, 2007 - v2
    Checksum:iC534549E44DDB9A1
    GO
    Isoform 2 (identifier: Q5VZY2-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         86-149: AVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDGVMNSEMHCTGDPDLVSEGRKSFPSIHSSF → V

    Note: No experimental confirmation available.
    Show »
    Length:208
    Mass (Da):23,509
    Checksum:i9C4052029FE63D0F
    GO
    Isoform 3 (identifier: Q5VZY2-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-189: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:82
    Mass (Da):9,175
    Checksum:iA228474E1B007DBA
    GO
    Isoform 4 (identifier: Q5VZY2-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         56-96: AISFLTPLAV...VSLALALNGV → IPLWVESSAS...PTLVCESQPH
         97-271: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:96
    Mass (Da):11,089
    Checksum:iDE39DF5B00D26259
    GO

    Sequence cautioni

    The sequence CAH70333 differs from that shown. Reason: Erroneous gene model prediction. Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 189189Missing in isoform 3. 1 PublicationVSP_025237Add
    BLAST
    Alternative sequencei56 – 9641AISFL…ALNGV → IPLWVESSASFLHTFATDST ILLWPTQLAINPTLVCESQP H in isoform 4. 1 PublicationVSP_025239Add
    BLAST
    Alternative sequencei86 – 14964AVSLA…IHSSF → V in isoform 2. 1 PublicationVSP_025238Add
    BLAST
    Alternative sequencei97 – 271175Missing in isoform 4. 1 PublicationVSP_025240Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    BD418666 mRNA. No translation available.
    AL157782, AC073587, AC023282 Genomic DNA. Translation: CAH70332.1. Different termination.
    AL157782, AC023282, AC073587 Genomic DNA. Translation: CAH70333.1. Sequence problems.
    BC101267 mRNA. Translation: AAI01268.1.
    BC101268 mRNA. Translation: AAI01269.1.
    BC101269 mRNA. Translation: AAI01270.1.
    BC122535 mRNA. Translation: AAI22536.1.
    BC132787 mRNA. Translation: AAI32788.1.
    CCDSiCCDS41573.1. [Q5VZY2-1]
    RefSeqiNP_001025230.1. NM_001030059.2. [Q5VZY2-1]
    NP_001305095.1. NM_001318166.1.
    NP_001305096.1. NM_001318167.1. [Q5VZY2-2]
    NP_001305097.1. NM_001318168.1.
    NP_001305098.1. NM_001318169.1. [Q5VZY2-4]
    UniGeneiHs.40479.

    Genome annotation databases

    EnsembliENST00000398250; ENSP00000381302; ENSG00000203805. [Q5VZY2-1]
    GeneIDi196051.
    KEGGihsa:196051.
    UCSCiuc001lev.1. human. [Q5VZY2-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    BD418666 mRNA. No translation available.
    AL157782, AC073587, AC023282 Genomic DNA. Translation: CAH70332.1. Different termination.
    AL157782, AC023282, AC073587 Genomic DNA. Translation: CAH70333.1. Sequence problems.
    BC101267 mRNA. Translation: AAI01268.1.
    BC101268 mRNA. Translation: AAI01269.1.
    BC101269 mRNA. Translation: AAI01270.1.
    BC122535 mRNA. Translation: AAI22536.1.
    BC132787 mRNA. Translation: AAI32788.1.
    CCDSiCCDS41573.1. [Q5VZY2-1]
    RefSeqiNP_001025230.1. NM_001030059.2. [Q5VZY2-1]
    NP_001305095.1. NM_001318166.1.
    NP_001305096.1. NM_001318167.1. [Q5VZY2-2]
    NP_001305097.1. NM_001318168.1.
    NP_001305098.1. NM_001318169.1. [Q5VZY2-4]
    UniGeneiHs.40479.

    3D structure databases

    ProteinModelPortaliQ5VZY2.
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi128189. 1 interaction.
    STRINGi9606.ENSP00000381302.

    Chemistry

    SwissLipidsiSLP:000000605.

    PTM databases

    DEPODiQ5VZY2.
    iPTMnetiQ5VZY2.
    PhosphoSiteiQ5VZY2.

    Polymorphism and mutation databases

    BioMutaiPPAPDC1A.
    DMDMi147721098.

    Proteomic databases

    PaxDbiQ5VZY2.
    PRIDEiQ5VZY2.

    Protocols and materials databases

    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000398250; ENSP00000381302; ENSG00000203805. [Q5VZY2-1]
    GeneIDi196051.
    KEGGihsa:196051.
    UCSCiuc001lev.1. human. [Q5VZY2-1]

    Organism-specific databases

    CTDi196051.
    GeneCardsiPPAPDC1A.
    HGNCiHGNC:23531. PLPP4.
    HPAiHPA045188.
    neXtProtiNX_Q5VZY2.
    PharmGKBiPA134907381.
    GenAtlasiSearch...

    Phylogenomic databases

    eggNOGiKOG3030. Eukaryota.
    COG0671. LUCA.
    GeneTreeiENSGT00510000046723.
    HOGENOMiHOG000215098.
    HOVERGENiHBG056764.
    InParanoidiQ5VZY2.
    OMAiKEEMPTA.
    OrthoDBiEOG091G0O0I.
    PhylomeDBiQ5VZY2.
    TreeFamiTF323722.

    Enzyme and pathway databases

    BRENDAi3.1.3.4. 2681.
    3.1.3.81. 2681.
    ReactomeiR-HSA-2029485. Role of phospholipids in phagocytosis.

    Miscellaneous databases

    ChiTaRSiPPAPDC1A. human.
    GeneWikiiPPAPDC1A.
    GenomeRNAii196051.
    PROiQ5VZY2.

    Gene expression databases

    BgeeiENSG00000203805.
    CleanExiHS_PPAPDC1A.
    ExpressionAtlasiQ5VZY2. baseline and differential.
    GenevisibleiQ5VZY2. HS.

    Family and domain databases

    Gene3Di1.20.144.10. 1 hit.
    InterProiIPR000326. P_Acid_Pase_2/haloperoxidase.
    IPR028668. PLPP4.
    [Graphical view]
    PANTHERiPTHR10165:SF90. PTHR10165:SF90. 1 hit.
    PfamiPF01569. PAP2. 1 hit.
    [Graphical view]
    SMARTiSM00014. acidPPc. 1 hit.
    [Graphical view]
    SUPFAMiSSF48317. SSF48317. 1 hit.
    ProtoNetiSearch...

    Entry informationi

    Entry nameiPLPP4_HUMAN
    AccessioniPrimary (citable) accession number: Q5VZY2
    Secondary accession number(s): A2RU82
    , Q08EQ2, Q0IIP2, Q495B4, Q5VZY1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 15, 2007
    Last sequence update: May 15, 2007
    Last modified: September 7, 2016
    This is version 100 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    Similar proteinsi

    Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
    100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
    90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
    50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.