Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lipase member M

Gene

LIPM

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Plays a highly specific role in the last step of keratinocyte differentiation. May have an essential function in lipid metabolism of the most differentiated epidermal layers.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei186NucleophileBy similarity1
Active sitei357Charge relay systemPROSITE-ProRule annotation1
Active sitei386Charge relay systemPROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase
Biological processLipid degradation, Lipid metabolism

Enzyme and pathway databases

ReactomeiR-HSA-6809371 Formation of the cornified envelope

Protein family/group databases

ESTHERihuman-LIPM Acidic_Lipase

Names & Taxonomyi

Protein namesi
Recommended name:
Lipase member M (EC:3.1.1.-)
Alternative name(s):
Lipase-like abhydrolase domain-containing protein 3
Gene namesi
Name:LIPM
Synonyms:LIPL3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000173239.13
HGNCiHGNC:23455 LIPM
MIMi613923 gene
neXtProtiNX_Q5VYY2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000173239
PharmGKBiPA162394101

Polymorphism and mutation databases

BioMutaiLIPM
DMDMi147647745

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 33Sequence analysisAdd BLAST33
ChainiPRO_000028682934 – 423Lipase member MAdd BLAST390

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi48N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi260 ↔ 269By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ5VYY2
PeptideAtlasiQ5VYY2
PRIDEiQ5VYY2

PTM databases

iPTMnetiQ5VYY2
PhosphoSitePlusiQ5VYY2

Expressioni

Tissue specificityi

Exclusively expressed in the epidermis within the granular keratinocytes.1 Publication

Gene expression databases

BgeeiENSG00000173239
CleanExiHS_LIPM

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000383901

Structurei

3D structure databases

ProteinModelPortaliQ5VYY2
SMRiQ5VYY2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini92 – 392AB hydrolase-1Sequence analysisAdd BLAST301

Sequence similaritiesi

Belongs to the AB hydrolase superfamily. Lipase family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG2624 Eukaryota
COG0596 LUCA
GeneTreeiENSGT00550000074328
HOGENOMiHOG000240694
HOVERGENiHBG006265
InParanoidiQ5VYY2
KOiK19406
OMAiPEWAHVD
OrthoDBiEOG091G09AX
PhylomeDBiQ5VYY2
TreeFamiTF315485

Family and domain databases

Gene3Di3.40.50.1820, 1 hit
InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR000073 AB_hydrolase_1
IPR025483 Lipase_euk
PfamiView protein in Pfam
PF00561 Abhydrolase_1, 1 hit
PIRSFiPIRSF000862 Steryl_ester_lip, 1 hit
SUPFAMiSSF53474 SSF53474, 1 hit
PROSITEiView protein in PROSITE
PS00120 LIPASE_SER, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5VYY2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLETLSRQWI VSHRMEMWLL ILVAYMFQRN VNSVHMPTKA VDPEAFMNIS
60 70 80 90 100
EIIQHQGYPC EEYEVATEDG YILSVNRIPR GLVQPKKTGS RPVVLLQHGL
110 120 130 140 150
VGGASNWISN LPNNSLGFIL ADAGFDVWMG NSRGNAWSRK HKTLSIDQDE
160 170 180 190 200
FWAFSYDEMA RFDLPAVINF ILQKTGQEKI YYVGYSQGTT MGFIAFSTMP
210 220 230 240 250
ELAQKIKMYF ALAPIATVKH AKSPGTKFLL LPDMMIKGLF GKKEFLYQTR
260 270 280 290 300
FLRQLVIYLC GQVILDQICS NIMLLLGGFN TNNMNMSRAS VYAAHTLAGT
310 320 330 340 350
SVQNILHWSQ AVNSGELRAF DWGSETKNLE KCNQPTPVRY RVRDMTVPTA
360 370 380 390 400
MWTGGQDWLS NPEDVKMLLS EVTNLIYHKN IPEWAHVDFI WGLDAPHRMY
410 420
NEIIHLMQQE ETNLSQGRCE AVL
Length:423
Mass (Da):48,233
Last modified:May 15, 2007 - v2
Checksum:i9B622EEB88F05478
GO
Isoform 2 (identifier: Q5VYY2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MLETLSRQWIVSHRMEMWLLILVAYMFQRNVNSVHMPTKAVDPEAFMNI → MTRPLDRKQ

Note: No experimental confirmation available.
Show »
Length:383
Mass (Da):43,498
Checksum:iEE47A6D52316C0FE
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_059382274L → S. Corresponds to variant dbSNP:rs3910680Ensembl.1
Natural variantiVAR_032191418R → W. Corresponds to variant dbSNP:rs11202862Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0562611 – 49MLETL…AFMNI → MTRPLDRKQ in isoform 2. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EF426484 mRNA Translation: ABR08389.1
AL353113 Genomic DNA No translation available.
AL358532 Genomic DNA No translation available.
BC157888 mRNA Translation: AAI57889.1
BC171908 mRNA Translation: AAI71908.1
CCDSiCCDS44457.1 [Q5VYY2-1]
RefSeqiNP_001121687.1, NM_001128215.1 [Q5VYY2-1]
UniGeneiHs.55118

Genome annotation databases

EnsembliENST00000404743; ENSP00000383901; ENSG00000173239 [Q5VYY2-1]
ENST00000539337; ENSP00000440375; ENSG00000173239 [Q5VYY2-2]
GeneIDi340654
KEGGihsa:340654
UCSCiuc009xtm.2 human [Q5VYY2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiLIPM_HUMAN
AccessioniPrimary (citable) accession number: Q5VYY2
Secondary accession number(s): A6PVS3, B2RXK7, B5MCR3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: May 15, 2007
Last modified: May 23, 2018
This is version 115 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health