Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mesenteric estrogen-dependent adipogenesis protein

Gene

MEDAG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Involved in processes that promote adipocyte differentiation, lipid accumulation, and glucose uptake in mature adipocytes.By similarity

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Mesenteric estrogen-dependent adipogenesis protein
Alternative name(s):
Activated in W/Wv mouse stomach 3 homolog
Short name:
hAWMS3
Mesenteric estrogen-dependent adipose 4
Short name:
MEDA-4
Gene namesi
Name:MEDAG
Synonyms:AWMS3, C13orf33, MEDA4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

HGNCiHGNC:25926. MEDAG.

Subcellular locationi

  • Cytoplasm 1 Publication

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA147358556.

Polymorphism and mutation databases

BioMutaiMEDAG.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 303303Mesenteric estrogen-dependent adipogenesis proteinPRO_0000274333Add
BLAST

Proteomic databases

EPDiQ5VYS4.
PaxDbiQ5VYS4.
PRIDEiQ5VYS4.

PTM databases

iPTMnetiQ5VYS4.
PhosphoSiteiQ5VYS4.

Expressioni

Tissue specificityi

Highly expressed in the visceral fat depot.1 Publication

Gene expression databases

BgeeiQ5VYS4.
CleanExiHS_C13orf33.
ExpressionAtlasiQ5VYS4. baseline and differential.
GenevisibleiQ5VYS4. HS.

Organism-specific databases

HPAiHPA053763.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000369849.

Structurei

3D structure databases

ProteinModelPortaliQ5VYS4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410IKGJ. Eukaryota.
ENOG411208I. LUCA.
GeneTreeiENSGT00390000018451.
HOGENOMiHOG000111804.
HOVERGENiHBG081258.
InParanoidiQ5VYS4.
OMAiDDVFNCN.
OrthoDBiEOG7RJPSW.
PhylomeDBiQ5VYS4.
TreeFamiTF328824.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5VYS4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGAACEPVA RPSLTSISSG ELRSLWTCDC ELALLPLAQL LRLQPGAFQL
60 70 80 90 100
SGDQLVVARP GEPAAARGGF NVFGDGLVRL DGQLYRLSSY IKRYVELTNY
110 120 130 140 150
CDYKDYRETI LSKPMLFFIN VQTKKDTSKE RTYAFLVNTR HPKIRRQIEQ
160 170 180 190 200
GMDMVISSVI GESYRLQFDF QEAVKNFFPP GNEVVNGENL SFAYEFKADA
210 220 230 240 250
LFDFFYWFGL SNSVVKVNGK VLNLSSTSPE KKETIKLFLE KMSEPLIRRS
260 270 280 290 300
SFSDRKFSVT SRGSIDDVFN CNLSPRSSLT EPLLAELPFP SVLESEETPN

QFI
Length:303
Mass (Da):34,190
Last modified:December 7, 2004 - v1
Checksum:iAAE14F897EA2C484
GO
Isoform 2 (identifier: Q5VYS4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-114: Missing.
     223-262: NLSSTSPEKKETIKLFLEKMSEPLIRRSSFSDRKFSVTSR → L

Show »
Length:150
Mass (Da):17,194
Checksum:i03DFF7F5C411C671
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti59 – 591R → G.2 Publications
Corresponds to variant rs9531945 [ dbSNP | Ensembl ].
VAR_030261

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 114114Missing in isoform 2. 1 PublicationVSP_022714Add
BLAST
Alternative sequencei223 – 26240NLSST…SVTSR → L in isoform 2. 1 PublicationVSP_022715Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027740 mRNA. No translation available.
AK055635 mRNA. Translation: BAB70975.1.
AL353680 Genomic DNA. Translation: CAH71733.1.
BC040165 mRNA. Translation: AAH40165.1.
BC101624 mRNA. Translation: AAI01625.1.
BC101626 mRNA. Translation: AAI01627.1.
AB055407 mRNA. Translation: BAC53805.1.
CCDSiCCDS9338.1. [Q5VYS4-1]
RefSeqiNP_116238.2. NM_032849.3.
UniGeneiHs.147880.
Hs.708377.

Genome annotation databases

EnsembliENST00000380482; ENSP00000369849; ENSG00000102802. [Q5VYS4-1]
GeneIDi84935.
KEGGihsa:84935.
UCSCiuc001uth.5. human. [Q5VYS4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027740 mRNA. No translation available.
AK055635 mRNA. Translation: BAB70975.1.
AL353680 Genomic DNA. Translation: CAH71733.1.
BC040165 mRNA. Translation: AAH40165.1.
BC101624 mRNA. Translation: AAI01625.1.
BC101626 mRNA. Translation: AAI01627.1.
AB055407 mRNA. Translation: BAC53805.1.
CCDSiCCDS9338.1. [Q5VYS4-1]
RefSeqiNP_116238.2. NM_032849.3.
UniGeneiHs.147880.
Hs.708377.

3D structure databases

ProteinModelPortaliQ5VYS4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000369849.

PTM databases

iPTMnetiQ5VYS4.
PhosphoSiteiQ5VYS4.

Polymorphism and mutation databases

BioMutaiMEDAG.

Proteomic databases

EPDiQ5VYS4.
PaxDbiQ5VYS4.
PRIDEiQ5VYS4.

Protocols and materials databases

DNASUi84935.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000380482; ENSP00000369849; ENSG00000102802. [Q5VYS4-1]
GeneIDi84935.
KEGGihsa:84935.
UCSCiuc001uth.5. human. [Q5VYS4-1]

Organism-specific databases

CTDi84935.
GeneCardsiMEDAG.
HGNCiHGNC:25926. MEDAG.
HPAiHPA053763.
neXtProtiNX_Q5VYS4.
PharmGKBiPA147358556.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IKGJ. Eukaryota.
ENOG411208I. LUCA.
GeneTreeiENSGT00390000018451.
HOGENOMiHOG000111804.
HOVERGENiHBG081258.
InParanoidiQ5VYS4.
OMAiDDVFNCN.
OrthoDBiEOG7RJPSW.
PhylomeDBiQ5VYS4.
TreeFamiTF328824.

Miscellaneous databases

GenomeRNAii84935.
NextBioi75380.
PROiQ5VYS4.

Gene expression databases

BgeeiQ5VYS4.
CleanExiHS_C13orf33.
ExpressionAtlasiQ5VYS4. baseline and differential.
GenevisibleiQ5VYS4. HS.

Family and domain databases

ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT GLY-59.
    Tissue: Ovary and Synovial cell.
  2. "The DNA sequence and analysis of human chromosome 13."
    Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
    Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLY-59.
    Tissue: Heart, Lung and Ovary.
  4. "Isolation and characterization of novel human and mouse genes, which are expressed in the digestive tract."
    Daigo Y., Takayama I., Fujino M.A.
    Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 92-303 (ISOFORM 1).
  5. "Novel genes of visceral adiposity: identification of mouse and human mesenteric estrogen-dependent adipose (MEDA)-4 gene and its adipogenic function."
    Zhang H., Chen X., Sairam M.R.
    Endocrinology 153:2665-2676(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiMEDAG_HUMAN
AccessioniPrimary (citable) accession number: Q5VYS4
Secondary accession number(s): Q8IXF1, Q96K26, Q96NC8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: December 7, 2004
Last modified: May 11, 2016
This is version 88 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.