Reviewed,
UniProtKB/Swiss-Prot Q5VYS4 (CM033_HUMAN)
Last modified
November 24, 2009.
Version 40.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: Uncharacterized protein C13orf33 Alternative name(s): Activated in W/Wv mouse stomach 3 homolog Short name=hAWMS3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 303 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5VYS4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5VYS4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-114: Missing. 223-262: NLSSTSPEKKETIKLFLEKMSEPLIRRSSFSDRKFSVTSR → L |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 303 | 303 | Uncharacterized protein C13orf33 | PRO_0000274333 | |||||
Natural variations | |||||||||
| Alternative sequence | 1 – 114 | 114 | Missing in isoform 2. | VSP_022714 | |||||
| Alternative sequence | 223 – 262 | 40 | NLSST…SVTSR → L in isoform 2. | VSP_022715 | |||||
| Natural variant | 59 | 1 | R → G: dbSNP rs9531945. Ref.1 Ref.3 | VAR_030261 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT GLY-59. Tissue: Ovary and Synovial cell. |
| [2] | "The DNA sequence and analysis of human chromosome 13." Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T. Ross M.T.Nature 428:522-528(2004) [PubMed: 15057823] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLY-59. Tissue: Heart, Lung and Ovary. |
| [4] | "Isolation and characterization of novel human and mouse genes, which are expressed in the digestive tract." Daigo Y., Takayama I., Fujino M.A. Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 92-303 (ISOFORM 1). |
Cross-references
Sequence databases | |
|---|---|
| AK027740 mRNA. No translation available. AK055635 mRNA. Translation: BAB70975.1. AL353680 Genomic DNA. Translation: CAH71733.1. BC040165 mRNA. Translation: AAH40165.1. BC101624 mRNA. Translation: AAI01625.1. BC101626 mRNA. Translation: AAI01627.1. AB055407 mRNA. Translation: BAC53805.1. | |
| IPI | IPI00043587. IPI00827969. |
| RefSeq | NP_116238.2. |
| UniGene | Hs.646647 Hs.708377 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q5VYS4. 1 interaction. |
Proteomic databases | |
| PRIDE | Q5VYS4. |
Genome annotation databases | |
| Ensembl | ENST00000380482; ENSP00000369849; ENSG00000102802; Homo sapiens. [Genome view] |
| GeneID | 84935. |
| KEGG | hsa:84935. |
| UCSC | uc001uth.2. human. |
Organism-specific databases | |
| CTD | 84935. |
| GeneCards | GC13P030379. |
| HGNC | HGNC:25926. C13orf33. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q5VYS4. |
| OMA | SKEKTYA |
| OrthoDB | EOG96T5N1 |
Gene expression databases | |
| ArrayExpress | Q5VYS4. |
| Bgee | Q5VYS4. |
| CleanEx | HS_C13orf33. |
| Genevestigator | Q5VYS4. |
Family and domain databases | |
| ProtoNet | Search... |
Entry information
| Entry name | CM033_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5VYS4 Secondary accession number(s): Q8IXF1, Q96K26, Q96NC8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 13 Human chromosome 13: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |

Clusters with


