Q5VYM1 (CI131_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 63.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Uncharacterized protein C9orf131 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1079 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Caution | It is uncertain whether Met-1 or Met-15 is the initiator. |
| Sequence caution | The sequence AAH45643.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5VYM1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5VYM1-2) The sequence of this isoform differs from the canonical sequence as follows: 1-52: MEWLLEDLLGAKGDMGLLWGQLTHALACRHCGSSCFQSPGNLVTLFLFVVWQ → MLRK | ||||||
| Isoform 3 (identifier: Q5VYM1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-76: MEWLLEDLLG...PWCSGNMVQG → MLR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1079 | 1079 | Uncharacterized protein C9orf131 | PRO_0000294443 | |||||
Natural variations | |||||||||
| Alternative sequence | 1 – 76 | 76 | MEWLL…NMVQG → MLR in isoform 3. | VSP_046225 | |||||
| Alternative sequence | 1 – 52 | 52 | MEWLL…FVVWQ → MLRK in isoform 2. | VSP_046224 | |||||
| Natural variant | 222 | 1 | W → L. Ref.2 Corresponds to variant rs615474 [ dbSNP | Ensembl ]. | VAR_047239 | |||||
| Natural variant | 285 | 1 | L → F. Corresponds to variant rs10117097 [ dbSNP | Ensembl ]. | VAR_047240 | |||||
| Natural variant | 437 | 1 | L → V. Corresponds to variant rs35523761 [ dbSNP | Ensembl ]. | VAR_047241 | |||||
| Natural variant | 623 | 1 | S → T. Corresponds to variant rs2298312 [ dbSNP | Ensembl ]. | VAR_047242 | |||||
| Natural variant | 916 | 1 | P → S. Corresponds to variant rs3739871 [ dbSNP | Ensembl ]. | VAR_047243 | |||||
Experimental info | |||||||||
| Sequence conflict | 218 | 1 | S → Y in AAH45643. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AL353795 Genomic DNA. Translation: CAH70992.1. BC045643 mRNA. Translation: AAH45643.1. Different initiation. AL133575 mRNA. Translation: CAB63722.1. |
| IPI | IPI00398256. IPI00744439. IPI00745209. |
| PIR | T43478. |
| RefSeq | NP_001035500.1. NM_001040410.1. NP_001035501.1. NM_001040411.1. NP_001035502.1. NM_001040412.1. NP_976044.2. NM_203299.2. |
| UniGene | Hs.148250. Hs.742567. |
3D structure databases | |
| ProteinModelPortal | Q5VYM1. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q5VYM1. 2 interactions. |
PTM databases | |
| PhosphoSite | Q5VYM1. |
Polymorphism databases | |
| DMDM | 212276515. |
Proteomic databases | |
| PaxDb | Q5VYM1. |
| PRIDE | Q5VYM1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000312292; ENSP00000308279; ENSG00000174038. ENST00000354479; ENSP00000346472; ENSG00000174038. ENST00000421362; ENSP00000393683; ENSG00000174038. |
| GeneID | 138724. |
| KEGG | hsa:138724. |
| UCSC | uc003zvw.3. human. |
Organism-specific databases | |
| CTD | 138724. |
| GeneCards | GC09P035024. |
| H-InvDB | HIX0114895. HIX0201378. |
| HGNC | HGNC:31418. C9orf131. |
| HPA | HPA022029. |
| neXtProt | NX_Q5VYM1. |
| PharmGKB | PA145149697. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG40075. |
| HOGENOM | HOG000111660. |
| HOVERGEN | HBG099349. |
| InParanoid | Q5VYM1. |
| OMA | RHCGSSC. |
| OrthoDB | EOG4QNMVH. |
Gene expression databases | |
| ArrayExpress | Q5VYM1. |
| Bgee | Q5VYM1. |
| CleanEx | HS_C9orf131. |
| Genevestigator | Q5VYM1. |
Family and domain databases | |
| InterPro | IPR026677. UPF_C9orf131. [Graphical view] |
| PANTHER | PTHR21777. PTHR21777. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 138724. |
| NextBio | 83825. |
Entry information
| Entry name | CI131_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5VYM1 Secondary accession number(s): A6NLE6 Q9UF74 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |

Clusters with
