Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2

Gene

NKAIN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei91 – 922Breakpoint for interstitial deletion to form SUSP1-NKAIN2

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2
Short name:
Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 2
Alternative name(s):
Protein FAM77B
T-cell lymphoma breakpoint-associated target protein 1
Gene namesi
Name:NKAIN2
Synonyms:FAM77B, TCBA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:16443. NKAIN2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei1 – 2323HelicalSequence analysisAdd
BLAST
Transmembranei35 – 5521HelicalSequence analysisAdd
BLAST
Transmembranei62 – 8221HelicalSequence analysisAdd
BLAST
Transmembranei153 – 17321HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving NKAIN2 is a cause of lymphoma. Deletion del(6)(q13q21) within NKAIN2 and involving SUSP1 generates the SUSP1-NKAIN2 product (PubMed:11979551).

Organism-specific databases

PharmGKBiPA162397563.

Polymorphism and mutation databases

BioMutaiNKAIN2.
DMDMi74747583.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 208208Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2PRO_0000265088Add
BLAST

Proteomic databases

PaxDbiQ5VXU1.
PeptideAtlasiQ5VXU1.
PRIDEiQ5VXU1.

PTM databases

iPTMnetiQ5VXU1.
PhosphoSiteiQ5VXU1.

Expressioni

Tissue specificityi

Expressed in fetal brain. Weakly expressed in adult brain and thymus. Not expressed in any other normal tissue examined.1 Publication

Gene expression databases

BgeeiENSG00000188580.
CleanExiHS_NKAIN2.
ExpressionAtlasiQ5VXU1. baseline and differential.
GenevisibleiQ5VXU1. HS.

Organism-specific databases

HPAiHPA045860.

Interactioni

Subunit structurei

Interacts with ATP1B1.By similarity

Protein-protein interaction databases

STRINGi9606.ENSP00000357402.

Structurei

3D structure databases

ProteinModelPortaliQ5VXU1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the NKAIN family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4556. Eukaryota.
ENOG410XS8X. LUCA.
GeneTreeiENSGT00390000013699.
HOGENOMiHOG000293382.
HOVERGENiHBG108190.
InParanoidiQ5VXU1.
OMAiACYVVKL.
OrthoDBiEOG091G0X6F.
PhylomeDBiQ5VXU1.
TreeFamiTF321348.

Family and domain databases

InterProiIPR008516. Na/K-Atpase_Interacting.
[Graphical view]
PANTHERiPTHR13084. PTHR13084. 1 hit.
PfamiPF05640. NKAIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5VXU1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGYCSGRCTL IFICGMQLVC VLERQIFDFL GYQWAPILAN FVHIIIVILG
60 70 80 90 100
LFGTIQYRPR YITGYAVWLV LWVTWNVFVI CFYLEAGDLS KETDLILTFN
110 120 130 140 150
ISMHRSWWME NGPGCTVTSV TPAPDWAPED HRYITVSGCL LEYQYIEVAH
160 170 180 190 200
SSLQIVLALA GFIYACYVVK CITEEEDSFD FIGGFDSYGY QGPQKTSHLQ

LQPMYMSK
Length:208
Mass (Da):23,831
Last modified:December 7, 2004 - v1
Checksum:i4877099BF4493A22
GO
Isoform 2 (identifier: Q5VXU1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     159-208: LAGFIYACYV...LQLQPMYMSK → VSVGSQPLLLVPLGLFYFCANSVHTNGICG

Note: No experimental confirmation available.
Show »
Length:188
Mass (Da):21,230
Checksum:i6E02A2397021DB01
GO
Isoform 3 (identifier: Q5VXU1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MGYCSGRCTLIFICGMQL → MGIIRFLLLYCPTNILT

Show »
Length:207
Mass (Da):23,816
Checksum:iBFCADCCFAE2861B8
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1818MGYCS…CGMQL → MGIIRFLLLYCPTNILT in isoform 3. 1 PublicationVSP_029298Add
BLAST
Alternative sequencei159 – 20850LAGFI…MYMSK → VSVGSQPLLLVPLGLFYFCA NSVHTNGICG in isoform 2. 1 PublicationVSP_021902Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB070452 mRNA. Translation: BAB85477.1.
AL354936
, AL121968, AL136224, AL356605 Genomic DNA. Translation: CAH73091.1.
AL354936, AL121968, AL356605 Genomic DNA. Translation: CAH73092.1.
AL356605
, AL121968, AL136224, AL354936 Genomic DNA. Translation: CAH73593.1.
AL356605, AL121968, AL354936 Genomic DNA. Translation: CAH73594.1.
AL121968
, AL136224, AL354936, AL356605 Genomic DNA. Translation: CAI19752.1.
AL121968, AL354936, AL356605 Genomic DNA. Translation: CAI19753.1.
AL136224
, AL121968, AL354936, AL356605 Genomic DNA. Translation: CAI20108.1.
BC035062 mRNA. Translation: AAH35062.1.
CCDSiCCDS34526.1. [Q5VXU1-1]
RefSeqiNP_001035304.1. NM_001040214.2. [Q5VXU1-1]
NP_001287666.1. NM_001300737.1. [Q5VXU1-3]
NP_001287667.1. NM_001300738.1.
NP_001287669.1. NM_001300740.1.
NP_699186.2. NM_153355.4.
UniGeneiHs.656604.

Genome annotation databases

EnsembliENST00000368416; ENSP00000357401; ENSG00000188580. [Q5VXU1-2]
ENST00000368417; ENSP00000357402; ENSG00000188580. [Q5VXU1-1]
ENST00000545433; ENSP00000437798; ENSG00000188580. [Q5VXU1-3]
GeneIDi154215.
KEGGihsa:154215.
UCSCiuc003pzn.2. human. [Q5VXU1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB070452 mRNA. Translation: BAB85477.1.
AL354936
, AL121968, AL136224, AL356605 Genomic DNA. Translation: CAH73091.1.
AL354936, AL121968, AL356605 Genomic DNA. Translation: CAH73092.1.
AL356605
, AL121968, AL136224, AL354936 Genomic DNA. Translation: CAH73593.1.
AL356605, AL121968, AL354936 Genomic DNA. Translation: CAH73594.1.
AL121968
, AL136224, AL354936, AL356605 Genomic DNA. Translation: CAI19752.1.
AL121968, AL354936, AL356605 Genomic DNA. Translation: CAI19753.1.
AL136224
, AL121968, AL354936, AL356605 Genomic DNA. Translation: CAI20108.1.
BC035062 mRNA. Translation: AAH35062.1.
CCDSiCCDS34526.1. [Q5VXU1-1]
RefSeqiNP_001035304.1. NM_001040214.2. [Q5VXU1-1]
NP_001287666.1. NM_001300737.1. [Q5VXU1-3]
NP_001287667.1. NM_001300738.1.
NP_001287669.1. NM_001300740.1.
NP_699186.2. NM_153355.4.
UniGeneiHs.656604.

3D structure databases

ProteinModelPortaliQ5VXU1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000357402.

PTM databases

iPTMnetiQ5VXU1.
PhosphoSiteiQ5VXU1.

Polymorphism and mutation databases

BioMutaiNKAIN2.
DMDMi74747583.

Proteomic databases

PaxDbiQ5VXU1.
PeptideAtlasiQ5VXU1.
PRIDEiQ5VXU1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000368416; ENSP00000357401; ENSG00000188580. [Q5VXU1-2]
ENST00000368417; ENSP00000357402; ENSG00000188580. [Q5VXU1-1]
ENST00000545433; ENSP00000437798; ENSG00000188580. [Q5VXU1-3]
GeneIDi154215.
KEGGihsa:154215.
UCSCiuc003pzn.2. human. [Q5VXU1-1]

Organism-specific databases

CTDi154215.
GeneCardsiNKAIN2.
HGNCiHGNC:16443. NKAIN2.
HPAiHPA045860.
MIMi609758. gene.
neXtProtiNX_Q5VXU1.
PharmGKBiPA162397563.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4556. Eukaryota.
ENOG410XS8X. LUCA.
GeneTreeiENSGT00390000013699.
HOGENOMiHOG000293382.
HOVERGENiHBG108190.
InParanoidiQ5VXU1.
OMAiACYVVKL.
OrthoDBiEOG091G0X6F.
PhylomeDBiQ5VXU1.
TreeFamiTF321348.

Miscellaneous databases

ChiTaRSiNKAIN2. human.
GenomeRNAii154215.
PROiQ5VXU1.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000188580.
CleanExiHS_NKAIN2.
ExpressionAtlasiQ5VXU1. baseline and differential.
GenevisibleiQ5VXU1. HS.

Family and domain databases

InterProiIPR008516. Na/K-Atpase_Interacting.
[Graphical view]
PANTHERiPTHR13084. PTHR13084. 1 hit.
PfamiPF05640. NKAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNKAI2_HUMAN
AccessioniPrimary (citable) accession number: Q5VXU1
Secondary accession number(s): Q8IYR4, Q8TF67
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: December 7, 2004
Last modified: September 7, 2016
This is version 101 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.