Q5VWQ8 (DAB2P_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 73.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Disabled homolog 2-interacting protein Short name=DAB2 interaction protein Short name=DAB2-interacting protein Alternative name(s): ASK-interacting protein 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1189 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Functions as a Ras GTPase-activating protein By similarity. Through its interaction with MAP3K5 disrupts the association of MAP3K5 with the inhibitory 14-3-3 complex. Mediates TNF/TRAF2-induced MAP3K5-JNK activation, while it inhibits CHUK-NF-kappa-B signaling. May act as a tumor suppressor gene. Ref.8 |
| Subunit structure | Interacts with MAP3K5, preferentially with its 'Ser-966' dephosphorylated form. On plasma membrane, exists in an inactive form complexed with TNFR1. In response to TNF, dissociates from TNFR1 complex, tranlocates to cytoplasm and forms part of an intracellular signaling complex comprising TRADD, RALBP1, TRAF2 and MAP3K5. Binding to MAP3K5 is induced by TNF. Interacts with DAB1 and DAB2 By similarity. Part of a cytoplasmic complex made of HIPK1, DAB2IP and MAP3K5 in response to TNF. This complex formation promotes MAP3K5-JNK activation and subsequent apoptosis. Ref.8 Ref.9 Ref.10 |
| Subcellular location | Membrane. Cytoplasm. Note: Translocates to the cytoplasm in response to TNF. Ref.9 Ref.10 |
| Tissue specificity | Low expression in prostate. Down-regulated in prostate cancer. Ref.1 |
| Domain | The C2 and Ras-GAP domains are required for the interaction with MAP3K5. |
| Involvement in disease | Note=A chromosomal aberration involving DAB2IP is found in a patient with acute myeloid leukemia (AML). Translocation t(9;11)(q34;q23) with MLL. May give rise to a MLL-DAB2IP fusion protein lacking the PH domain. |
| Sequence similarities | Contains 1 C2 domain. Contains 1 PH domain. Contains 1 Ras-GAP domain. |
| Sequence caution | The sequence CAH72155.3 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5VWQ8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Gene prediction based on EST data. | ||||||
| Isoform 2 (identifier: Q5VWQ8-2) The sequence of this isoform differs from the canonical sequence as follows: 1-124: Missing. | ||||||
| Isoform 3 (identifier: Q5VWQ8-3) The sequence of this isoform differs from the canonical sequence as follows: 1-193: Missing. 1158-1189: RYSMQARNGISPTNPTKLQITENGEFRNSSNC → SMH | ||||||
| Isoform 4 (identifier: Q5VWQ8-4) The sequence of this isoform differs from the canonical sequence as follows: 1-124: Missing. 1158-1189: RYSMQARNGISPTNPTKLQITENGEFRNSSNC → SMH |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1189 | 1189 | Disabled homolog 2-interacting protein | PRO_0000252407 | |||||
Regions | |||||||||
| Domain | 101 – 202 | 102 | PH | ||||||
| Domain | 200 – 295 | 96 | C2 | ||||||
| Domain | 371 – 563 | 193 | Ras-GAP | ||||||
| Coiled coil | 1026 – 1159 | 134 | Potential | ||||||
| Compositional bias | 8 – 52 | 45 | Arg-rich | ||||||
| Compositional bias | 112 – 117 | 6 | Poly-Ala | ||||||
| Compositional bias | 867 – 870 | 4 | Poly-Ala | ||||||
| Compositional bias | 903 – 948 | 46 | Pro-rich | ||||||
Sites | |||||||||
| Site | 172 – 173 | 2 | Breakpoint for translocation to form MLL-DAB2IP | ||||||
Amino acid modifications | |||||||||
| Modified residue | 702 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 747 | 1 | Phosphoserine Ref.14 | ||||||
| Modified residue | 978 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 992 | 1 | Phosphoserine Ref.13 | ||||||
| Modified residue | 995 | 1 | Phosphoserine Ref.13 | ||||||
| Modified residue | 1168 | 1 | Phosphoserine Ref.12 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 193 | 193 | Missing in isoform 3. | VSP_020952 | |||||
| Alternative sequence | 1 – 124 | 124 | Missing in isoform 2 and isoform 4. | VSP_020953 | |||||
| Alternative sequence | 1158 – 1189 | 32 | RYSMQ…NSSNC → SMH in isoform 3 and isoform 4. | VSP_020954 | |||||
| Natural variant | 59 | 1 | S → F. Corresponds to variant rs7027492 [ dbSNP | Ensembl ]. | VAR_056858 | |||||
Experimental info | |||||||||
| Mutagenesis | 228 – 230 | 3 | KKK → AAA: No effect on binding to MAP3K5. Ref.8 | ||||||
| Mutagenesis | 281 – 284 | 4 | KKKK → AAAA: Significantly reduced binding to MAP3K5. Ref.8 | ||||||
| Mutagenesis | 413 | 1 | R → L: No effect on binding to MAP3K5. Ref.8 | ||||||
| Sequence conflict | 482 | 1 | I → T in AAM00371. Ref.1 | ||||||
| Sequence conflict | 921 | 1 | P → S in AAM00371. Ref.1 | ||||||
| Sequence conflict | 1091 – 1092 | 2 | QQ → HE in AAM00371. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Differential regulation of the human gene DAB2IP in normal and malignant prostatic epithelia: cloning and characterization." Chen H., Pong R.-C., Wang Z., Hsieh J.-T. Genomics 79:573-581(2002) [PubMed: 11944990] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY. |
| [2] | "Identification of a novel RAS GTPase-activating protein (RASGAP) gene at 9q34 as an MLL fusion partner in a patient with de novo acute myeloid leukemia." von Bergh A.R.M., Wijers P.M., Groot A.J., van Zelderen-Bhola S., Falkenburg J.H.F., Kluin P.M., Schuuring E. Genes Chromosomes Cancer 39:324-334(2004) [PubMed: 14978793] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), CHROMOSOMAL TRANSLOCATION WITH MLL. |
| [3] | "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O. DNA Res. 7:347-355(2000) [PubMed: 11214970] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Brain. |
| [4] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed: 12168954] [Abstract] Cited for: SEQUENCE REVISION. |
| [5] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed: 15164053] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). |
| [8] | "AIP1 mediates TNF-alpha-induced ASK1 activation by facilitating dissociation of ASK1 from its inhibitor 14-3-3." Zhang R., He X., Liu W., Lu M., Hsieh J.-T., Min W. J. Clin. Invest. 111:1933-1943(2003) [PubMed: 12813029] [Abstract] Cited for: FUNCTION, INTERACTION WITH MAP3K5, MUTAGENESIS OF 228-LYS--LYS-230; 281-LYS--LYS-284 AND ARG-413. |
| [9] | "AIP1/DAB2IP, a novel member of the Ras-GAP family, transduces TRAF2-induced ASK1-JNK activation." Zhang H., Zhang R., Luo Y., D'Alessio A., Pober J.S., Min W. J. Biol. Chem. 279:44955-44965(2004) [PubMed: 15310755] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH TNFR1; MAP3K5; TRADD; RALBP1 AND TRAF2. |
| [10] | "Tumor necrosis factor alpha-induced desumoylation and cytoplasmic translocation of homeodomain-interacting protein kinase 1 are critical for apoptosis signal-regulating kinase 1-JNK/p38 activation." Li X., Zhang R., Luo D., Park S.-J., Wang Q., Kim Y., Min W. J. Biol. Chem. 280:15061-15070(2005) [PubMed: 15701637] [Abstract] Cited for: INTERACTION WITH HIPK1, SUBCELLULAR LOCATION. |
| [11] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-702, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis." Wang B., Malik R., Nigg E.A., Korner R. Anal. Chem. 80:9526-9533(2008) [PubMed: 19007248] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1168, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-992 AND SER-995, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-747, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF367051 mRNA. Translation: AAM00371.1. AY032952 mRNA. Translation: AAK50336.1. AB051530 mRNA. Translation: BAB21834.2. AL365274 Genomic DNA. Translation: CAH72155.3. Sequence problems. AL365274 Genomic DNA. Translation: CAQ10385.1. AL365274 Genomic DNA. Translation: CAH72158.1. CH471090 Genomic DNA. Translation: EAW87503.1. BC146762 mRNA. Translation: AAI46763.1. |
| IPI | IPI00045600. IPI00646394. IPI00789361. IPI00914911. |
| RefSeq | NP_115941.2. NM_032552.2. NP_619723.1. NM_138709.1. |
| UniGene | Hs.522378. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1NF1 based on UniProtKB P21359. |
| ProteinModelPortal | Q5VWQ8. |
| SMR | Q5VWQ8. Positions 145-202, 212-315, 329-662. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q5VWQ8. 1 interaction. |
| MINT | MINT-268247. |
| STRING | Q5VWQ8. |
PTM databases | |
| PhosphoSite | Q5VWQ8. |
Polymorphism databases | |
| DMDM | 116247768. |
Proteomic databases | |
| PRIDE | Q5VWQ8. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000408936; ENSP00000386183; ENSG00000136848. |
| GeneID | 153090. |
| KEGG | hsa:153090. |
| UCSC | uc004bln.1. human. uc004blo.1. human. |
Organism-specific databases | |
| CTD | 153090. |
| GeneCards | GC09P124329. |
| HGNC | HGNC:17294. DAB2IP. |
| HPA | HPA036977. |
| MIM | 609205. gene. |
| neXtProt | NX_Q5VWQ8. |
| PharmGKB | PA27133. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG11192. |
| GeneTree | ENSGT00600000084217. |
| HOVERGEN | HBG006492. |
| InParanoid | Q5VWQ8. |
| OMA | QLPGTND. |
| OrthoDB | EOG473PQJ. |
| PhylomeDB | Q5VWQ8. |
Gene expression databases | |
| ArrayExpress | Q5VWQ8. |
| Bgee | Q5VWQ8. |
| CleanEx | HS_DAB2IP. |
| Genevestigator | Q5VWQ8. |
| GermOnline | ENSG00000136848. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR021887. DUF3498. IPR011993. PH_type. IPR001849. Pleckstrin_homology. IPR001936. RasGAP. IPR023152. RasGAP_CS. IPR008936. Rho_GTPase_activation_prot. [Graphical view] |
| Gene3D | G3DSA:2.30.29.30. PH_type. 1 hit. G3DSA:1.10.506.10. RasGAP. 1 hit. |
| Pfam | PF00168. C2. 1 hit. PF12004. DUF3498. 1 hit. PF00616. RasGAP. 1 hit. [Graphical view] |
| SMART | SM00239. C2. 1 hit. SM00233. PH. 1 hit. SM00323. RasGAP. 1 hit. [Graphical view] |
| SUPFAM | SSF49562. C2_CaLB. 1 hit. SSF48350. Rho_GAP. 1 hit. |
| PROSITE | PS50004. C2. False negative. PS50003. PH_DOMAIN. 1 hit. PS00509. RAS_GTPASE_ACTIV_1. 1 hit. PS50018. RAS_GTPASE_ACTIV_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 87071. |
| SOURCE | Search... |
Entry information
| Entry name | DAB2P_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5VWQ8 Secondary accession number(s): A6H8V2 Q9C0C0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with