Q5VWP3 (MLIP_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 66.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Muscular LMNA-interacting protein Alternative name(s): Muscular-enriched A-type laminin-interacting protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 458 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subunit structure | Interacts with LMNA; may regulate MLIP localization to the nucleus envelope. Ref.4 |
| Subcellular location | Nucleus By similarity. Nucleus envelope By similarity. Nucleus › PML body By similarity. |
| Tissue specificity | Primarily expressed in heart and skeletal muscle. Also detected in liver. Ref.4 |
| Sequence caution | The sequence CAI13927.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | PML body Inferred from sequence or structural similarity. Source: UniProtKB nuclear envelopeInferred from sequence or structural similarity. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist according to PubMed=21498514. | ||||||
| Isoform 1 (identifier: Q5VWP3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5VWP3-2) The sequence of this isoform differs from the canonical sequence as follows: 1-73: MELEKREKRS...SDKSPETVNR → MCSWYLGFECS 205-298: Missing. 372-439: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q5VWP3-3) The sequence of this isoform differs from the canonical sequence as follows: 1-21: MELEKREKRSLLNKNLEEKLT → MLSEQGLLSDCGNNYFQMTSCILSGSIQTTPQ 204-204: Q → QLTSSPTTSE...STGPENKKSK | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 458 | 458 | Muscular LMNA-interacting protein | PRO_0000089538 | |||||
Regions | |||||||||
| Region | 1 – 40 | 40 | Interaction with LMNA | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 73 | 73 | MELEK…ETVNR → MCSWYLGFECS in isoform 2. | VSP_015320 | |||||
| Alternative sequence | 1 – 21 | 21 | MELEK…EEKLT → MLSEQGLLSDCGNNYFQMTS CILSGSIQTTPQ in isoform 3. | VSP_041463 | |||||
| Alternative sequence | 204 | 1 | Q → QLTSSPTTSEQLACKPPAFS FVSPTNPNTPPDPVNLEGAS VLEEFHTRRLDVGGAVVEES ATYFQTTAHSTPFSASKGTS STLLFPHSTQLSGSNLPSST AADPKPGLTSEVLKKTTLTS HVLSHGESPRTSSSPPSSSA SLKSNSASYIPVRIVTHSLS PSPKPFTSSFHGSSSTICSQ MSSSGNLSKSGVKSPVPSRL ALLTAILKSNPSHQRPFSPA SCPTFSLNSPASSTLTLDQK EKQTPPTPKKSLSSCSLRAG SPDQGELQVSELTQQSFHLP VFTKSTPLSQAPSLSPTKQA SSSLASMNVERTPSPTLKSN TMLSLLQTSTSSSVGLPPVP PSSSLSSLKSKQDGDLRGPE NPRNIHTYPSTLASSALSSL SPPINQRATFSSSEKCFHPS PALSSLINRSKRASSQLSGQ ELNPSALPSLPVSSADFASL PNLRSSSLPHANLPTLVPQL SPSALHPHCGSGTLPSRLGK SESTTPNHRSPVSTPSLPIS LTRTEELISPCALSMSTGPE NKKSK in isoform 3. | VSP_041464 | |||||
| Alternative sequence | 205 – 298 | 94 | Missing in isoform 2. | VSP_015321 | |||||
| Alternative sequence | 372 – 439 | 68 | Missing in isoform 2. | VSP_015322 | |||||
| Natural variant | 6 | 1 | R → H. Corresponds to variant rs17625497 [ dbSNP | Ensembl ]. | VAR_033676 | |||||
| Natural variant | 159 | 1 | V → I. Ref.1 Ref.3 Corresponds to variant rs4712056 [ dbSNP | Ensembl ]. | VAR_023381 | |||||
| Natural variant | 320 | 1 | S → T. Ref.1 Ref.3 Corresponds to variant rs6934690 [ dbSNP | Ensembl ]. | VAR_023382 | |||||
| Natural variant | 376 | 1 | P → S. Corresponds to variant rs2275769 [ dbSNP | Ensembl ]. | VAR_056800 | |||||
Experimental info | |||||||||
| Sequence conflict | 355 | 1 | N → T in AAH09010. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANTS ILE-159 AND THR-320. Tissue: Brain and Heart. |
| [2] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS ILE-159 AND THR-320. Tissue: Brain. |
| [4] | "Identification of a novel muscle enriched A-type Lamin interacting protein (MLIP)." Ahmady E., Deeke S.A., Rabaa S., Kouri L., Kenney L., Stewart A.F., Burgon P.G. J. Biol. Chem. 286:19702-19713(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH LMNA, TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK055530 mRNA. Translation: BAB70942.1. AK294890 mRNA. Translation: BAH11916.1. AL365328, AL139389, AL359380 Genomic DNA. Translation: CAH73017.1. AL139389, AL359380, AL365328 Genomic DNA. Translation: CAI13927.1. Sequence problems. AL359380, AL139389, AL365328 Genomic DNA. Translation: CAI16270.1. BC009010 mRNA. Translation: AAH09010.1. |
| IPI | IPI00043637. IPI00749329. IPI00922212. |
| RefSeq | NP_612636.2. NM_138569.2. |
| UniGene | Hs.382212. Hs.591803. |
3D structure databases | |
| ProteinModelPortal | Q5VWP3. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q5VWP3. 1 interaction. |
| STRING | 9606.ENSP00000274897. |
PTM databases | |
| PhosphoSite | Q5VWP3. |
Polymorphism databases | |
| DMDM | 296439407. |
Proteomic databases | |
| PaxDb | Q5VWP3. |
| PRIDE | Q5VWP3. |
Protocols and materials databases | |
| DNASU | 90523. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000274897; ENSP00000274897; ENSG00000146147. ENST00000370876; ENSP00000359913; ENSG00000146147. ENST00000502396; ENSP00000426290; ENSG00000146147. |
| GeneID | 90523. |
| KEGG | hsa:90523. |
| UCSC | uc003pcg.4. human. uc003pch.4. human. uc011dxa.2. human. |
Organism-specific databases | |
| CTD | 90523. |
| GeneCards | GC06P053796. |
| H-InvDB | HIX0022507. |
| HGNC | HGNC:21355. MLIP. |
| HPA | HPA046654. |
| MIM | 614106. gene. |
| neXtProt | NX_Q5VWP3. |
| PharmGKB | PA134918634. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG47342. |
| HOVERGEN | HBG105906. |
| InParanoid | Q5VWP3. |
| OMA | KKPKQYK. |
| PhylomeDB | Q5VWP3. |
Gene expression databases | |
| ArrayExpress | Q5VWP3. |
| Bgee | Q5VWP3. |
| CleanEx | HS_C6orf142. |
| Genevestigator | Q5VWP3. |
| GermOnline | ENSG00000146147. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| ChiTaRS | MLIP. human. |
| GenomeRNAi | 90523. |
| NextBio | 76813. |
| SOURCE | Search... |
Entry information
| Entry name | MLIP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5VWP3 Secondary accession number(s): B7Z2N0, Q96H08, Q96NF7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with
