Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5VTY9

- HHAT_HUMAN

UniProt

Q5VTY9 - HHAT_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein-cysteine N-palmitoyltransferase HHAT

Gene

HHAT

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Catalyzes N-terminal palmitoylation of SHH; which is required for SHH signaling (By similarity). May bind GTP.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei379 – 3791Sequence Analysis

GO - Molecular functioni

  1. GTP binding Source: UniProtKB-KW
  2. palmitoyltransferase activity Source: Ensembl

GO - Biological processi

  1. multicellular organismal development Source: UniProtKB-KW
  2. protein palmitoylation Source: Ensembl
  3. smoothened signaling pathway Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Acyltransferase, Developmental protein, Transferase

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLinkiQ5VTY9.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein-cysteine N-palmitoyltransferase HHAT (EC:2.3.1.-)
Alternative name(s):
Hedgehog acyltransferase
Melanoma antigen recognized by T-cells 2
Short name:
MART-2
Skinny hedgehog protein 1
Gene namesi
Name:HHAT
Synonyms:MART2, SKI1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:18270. HHAT.

Subcellular locationi

GO - Cellular componenti

  1. endoplasmic reticulum Source: UniProtKB-KW
  2. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

Orphaneti1422. Chondrodysplasia - disorder of sex development.
PharmGKBiPA134926499.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 493493Protein-cysteine N-palmitoyltransferase HHATPRO_0000213134Add
BLAST

Proteomic databases

PRIDEiQ5VTY9.

PTM databases

PhosphoSiteiQ5VTY9.

Expressioni

Tissue specificityi

Ubiquitously expressed in normal tissues and cancer cell lines.1 Publication

Gene expression databases

BgeeiQ5VTY9.
CleanExiHS_HHAT.
ExpressionAtlasiQ5VTY9. baseline and differential.
GenevestigatoriQ5VTY9.

Organism-specific databases

HPAiHPA016462.

Interactioni

Protein-protein interaction databases

BioGridi120852. 1 interaction.
STRINGi9606.ENSP00000261458.

Structurei

3D structure databases

ProteinModelPortaliQ5VTY9.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei5 – 2521HelicalSequence AnalysisAdd
BLAST
Transmembranei69 – 8921HelicalSequence AnalysisAdd
BLAST
Transmembranei95 – 11521HelicalSequence AnalysisAdd
BLAST
Transmembranei133 – 15220HelicalSequence AnalysisAdd
BLAST
Transmembranei200 – 22021HelicalSequence AnalysisAdd
BLAST
Transmembranei251 – 27121HelicalSequence AnalysisAdd
BLAST
Transmembranei290 – 31021HelicalSequence AnalysisAdd
BLAST
Transmembranei360 – 38021HelicalSequence AnalysisAdd
BLAST
Transmembranei429 – 44921HelicalSequence AnalysisAdd
BLAST
Transmembranei467 – 48721HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni448 – 4558GTP-bindingCurated

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1696.
GeneTreeiENSGT00530000063629.
HOGENOMiHOG000015758.
HOVERGENiHBG106485.
InParanoidiQ5VTY9.
OMAiQIDSDST.
OrthoDBiEOG7JT6W2.
PhylomeDBiQ5VTY9.
TreeFamiTF315826.

Family and domain databases

InterProiIPR004299. MBOAT_fam.
[Graphical view]
PfamiPF03062. MBOAT. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5VTY9-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLPRWELALY LLASLGFHFY SFYEVYKVSR EHEEELDQEF ELETDTLFGG
60 70 80 90 100
LKKDATDFEW SFWMEWGKQW LVWLLLGHMV VSQMATLLAR KHRPWILMLY
110 120 130 140 150
GMWACWCVLG TPGVAMVLLH TTISFCVAQF RSQLLTWLCS LLLLSTLRLQ
160 170 180 190 200
GVEEVKRRWY KTENEYYLLQ FTLTVRCLYY TSFSLELCWQ QLPAASTSYS
210 220 230 240 250
FPWMLAYVFY YPVLHNGPIL SFSEFIKQMQ QQEHDSLKAS LCVLALGLGR
260 270 280 290 300
LLCWWWLAEL MAHLMYMHAI YSSIPLLETV SCWTLGGLAL AQVLFFYVKY
310 320 330 340 350
LVLFGVPALL MRLDGLTPPA LPRCVSTMFS FTGMWRYFDV GLHNFLIRYV
360 370 380 390 400
YIPVGGSQHG LLGTLFSTAM TFAFVSYWHG GYDYLWCWAA LNWLGVTVEN
410 420 430 440 450
GVRRLVETPC IQDSLARYFS PQARRRFHAA LASCSTSMLI LSNLVFLGGN
460 470 480 490
EVGKTYWNRI FIQGWPWVTL SVLGFLYCYS HVGIAWAQTY ATD
Length:493
Mass (Da):57,313
Last modified:December 7, 2004 - v1
Checksum:i5E962E2A61F2DE15
GO
Isoform 2 (identifier: Q5VTY9-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     91-155: Missing.
     465-493: WPWVTLSVLGFLYCYSHVGIAWAQTYATD → GLFLFFLLNP...IENTSELSSY

Show »
Length:453
Mass (Da):52,891
Checksum:i83441A7D3EAE5A84
GO
Isoform 3 (identifier: Q5VTY9-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     465-493: WPWVTLSVLGFLYCYSHVGIAWAQTYATD → GLFLFFLLNP...IENTSELSSY

Note: No experimental confirmation available.

Show »
Length:518
Mass (Da):60,308
Checksum:i9FDB3E0136FB3AFE
GO
Isoform 4 (identifier: Q5VTY9-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-369: Missing.
     416-451: ARYFSPQARRRFHAALASCSTSMLILSNLVFLGGNE → VSRILAPVLGDSGTRQIRFIRDGAIRFPAPTMGPFY
     452-493: Missing.

Show »
Length:82
Mass (Da):9,328
Checksum:iE6DA1D13019D20A2
GO
Isoform 5 (identifier: Q5VTY9-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     91-155: Missing.

Note: No experimental confirmation available.

Show »
Length:428
Mass (Da):49,896
Checksum:i0EDD316948355C70
GO
Isoform 6 (identifier: Q5VTY9-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     92-228: Missing.

Note: No experimental confirmation available.

Show »
Length:356
Mass (Da):41,100
Checksum:i7F78984C97B46E08
GO
Isoform 7 (identifier: Q5VTY9-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MLPRWELALYLLASLGFHFYSFYEVYKVSR → MSLGLGSAERGVLGTRGARERCRRRRPGQPG

Note: No experimental confirmation available.

Show »
Length:494
Mass (Da):56,951
Checksum:i52FA7301CED685EF
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti2 – 21L → P in BAA91772. (PubMed:14702039)Curated
Sequence conflicti204 – 2041M → V in BAH14561. (PubMed:14702039)Curated
Sequence conflicti450 – 4501N → D in BAA91772. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti165 – 1651E → G.
Corresponds to variant rs2228898 [ dbSNP | Ensembl ].
VAR_050024
Natural varianti182 – 1821S → N.1 Publication
Corresponds to variant rs2294851 [ dbSNP | Ensembl ].
VAR_024743
Natural varianti188 – 1881C → R.1 Publication
Corresponds to variant rs34228541 [ dbSNP | Ensembl ].
VAR_061336
Natural varianti448 – 4481G → E in a melanoma cell line; abolishes GTP-binding.
VAR_024744
Natural varianti450 – 4501N → S in a lung cancer cell line. 1 Publication
VAR_024745

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 369369Missing in isoform 4. 1 PublicationVSP_016685Add
BLAST
Alternative sequencei1 – 3030MLPRW…YKVSR → MSLGLGSAERGVLGTRGARE RCRRRRPGQPG in isoform 7. 1 PublicationVSP_044968Add
BLAST
Alternative sequencei91 – 15565Missing in isoform 2 and isoform 5. 3 PublicationsVSP_016686Add
BLAST
Alternative sequencei92 – 228137Missing in isoform 6. 1 PublicationVSP_043481Add
BLAST
Alternative sequencei416 – 45136ARYFS…LGGNE → VSRILAPVLGDSGTRQIRFI RDGAIRFPAPTMGPFY in isoform 4. 1 PublicationVSP_016687Add
BLAST
Alternative sequencei452 – 49342Missing in isoform 4. 1 PublicationVSP_016688Add
BLAST
Alternative sequencei465 – 49329WPWVT…TYATD → GLFLFFLLNPCWETAFQGFP VFLHFLQTEVLATFVPNYFS WNICIENTSELSSY in isoform 2 and isoform 3. 2 PublicationsVSP_016689Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK001586 mRNA. Translation: BAA91772.1.
AK297193 mRNA. Translation: BAH12521.1.
AK298991 mRNA. Translation: BAH12917.1.
AK302955 mRNA. Translation: BAH13854.1.
AK316190 mRNA. Translation: BAH14561.1.
AK316524 mRNA. Translation: BAH14895.1.
CR936628 mRNA. Translation: CAI56771.1.
AL590653
, AC096636, AL034351, AL035414, AL691441 Genomic DNA. Translation: CAH70523.1.
AL034351 Genomic DNA. Translation: CAI23103.1.
AL034351
, AC096636, AL035414, AL590653, AL691441 Genomic DNA. Translation: CAI23104.1.
AL035414
, AC096636, AL034351, AL590653, AL691441 Genomic DNA. Translation: CAI22284.1.
AL691441
, AC096636, AL034351, AL035414, AL590653 Genomic DNA. Translation: CAI17039.1.
BX255872 Genomic DNA. No translation available.
CH471100 Genomic DNA. Translation: EAW93427.1.
CH471100 Genomic DNA. Translation: EAW93428.1.
CH471100 Genomic DNA. Translation: EAW93430.1.
BC117130 mRNA. Translation: AAI17131.1.
AL049848 mRNA. Translation: CAB42852.1.
CCDSiCCDS1495.1. [Q5VTY9-1]
CCDS53471.1. [Q5VTY9-7]
CCDS53472.1. [Q5VTY9-5]
CCDS53473.1. [Q5VTY9-6]
RefSeqiNP_001116306.1. NM_001122834.3. [Q5VTY9-1]
NP_001164035.1. NM_001170564.2. [Q5VTY9-6]
NP_001164051.1. NM_001170580.2. [Q5VTY9-1]
NP_001164058.1. NM_001170587.2. [Q5VTY9-7]
NP_001164059.1. NM_001170588.2. [Q5VTY9-5]
NP_060664.2. NM_018194.5. [Q5VTY9-1]
UniGeneiHs.58650.

Genome annotation databases

EnsembliENST00000261458; ENSP00000261458; ENSG00000054392. [Q5VTY9-1]
ENST00000367010; ENSP00000355977; ENSG00000054392. [Q5VTY9-1]
ENST00000413764; ENSP00000416845; ENSG00000054392. [Q5VTY9-1]
ENST00000537898; ENSP00000442625; ENSG00000054392. [Q5VTY9-5]
ENST00000541565; ENSP00000444995; ENSG00000054392. [Q5VTY9-6]
ENST00000545154; ENSP00000438468; ENSG00000054392. [Q5VTY9-7]
GeneIDi55733.
KEGGihsa:55733.
UCSCiuc001hhz.4. human. [Q5VTY9-1]
uc009xcy.3. human. [Q5VTY9-5]
uc010psq.2. human. [Q5VTY9-6]

Polymorphism databases

DMDMi74747010.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK001586 mRNA. Translation: BAA91772.1 .
AK297193 mRNA. Translation: BAH12521.1 .
AK298991 mRNA. Translation: BAH12917.1 .
AK302955 mRNA. Translation: BAH13854.1 .
AK316190 mRNA. Translation: BAH14561.1 .
AK316524 mRNA. Translation: BAH14895.1 .
CR936628 mRNA. Translation: CAI56771.1 .
AL590653
, AC096636 , AL034351 , AL035414 , AL691441 Genomic DNA. Translation: CAH70523.1 .
AL034351 Genomic DNA. Translation: CAI23103.1 .
AL034351
, AC096636 , AL035414 , AL590653 , AL691441 Genomic DNA. Translation: CAI23104.1 .
AL035414
, AC096636 , AL034351 , AL590653 , AL691441 Genomic DNA. Translation: CAI22284.1 .
AL691441
, AC096636 , AL034351 , AL035414 , AL590653 Genomic DNA. Translation: CAI17039.1 .
BX255872 Genomic DNA. No translation available.
CH471100 Genomic DNA. Translation: EAW93427.1 .
CH471100 Genomic DNA. Translation: EAW93428.1 .
CH471100 Genomic DNA. Translation: EAW93430.1 .
BC117130 mRNA. Translation: AAI17131.1 .
AL049848 mRNA. Translation: CAB42852.1 .
CCDSi CCDS1495.1. [Q5VTY9-1 ]
CCDS53471.1. [Q5VTY9-7 ]
CCDS53472.1. [Q5VTY9-5 ]
CCDS53473.1. [Q5VTY9-6 ]
RefSeqi NP_001116306.1. NM_001122834.3. [Q5VTY9-1 ]
NP_001164035.1. NM_001170564.2. [Q5VTY9-6 ]
NP_001164051.1. NM_001170580.2. [Q5VTY9-1 ]
NP_001164058.1. NM_001170587.2. [Q5VTY9-7 ]
NP_001164059.1. NM_001170588.2. [Q5VTY9-5 ]
NP_060664.2. NM_018194.5. [Q5VTY9-1 ]
UniGenei Hs.58650.

3D structure databases

ProteinModelPortali Q5VTY9.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120852. 1 interaction.
STRINGi 9606.ENSP00000261458.

PTM databases

PhosphoSitei Q5VTY9.

Polymorphism databases

DMDMi 74747010.

Proteomic databases

PRIDEi Q5VTY9.

Protocols and materials databases

DNASUi 55733.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000261458 ; ENSP00000261458 ; ENSG00000054392 . [Q5VTY9-1 ]
ENST00000367010 ; ENSP00000355977 ; ENSG00000054392 . [Q5VTY9-1 ]
ENST00000413764 ; ENSP00000416845 ; ENSG00000054392 . [Q5VTY9-1 ]
ENST00000537898 ; ENSP00000442625 ; ENSG00000054392 . [Q5VTY9-5 ]
ENST00000541565 ; ENSP00000444995 ; ENSG00000054392 . [Q5VTY9-6 ]
ENST00000545154 ; ENSP00000438468 ; ENSG00000054392 . [Q5VTY9-7 ]
GeneIDi 55733.
KEGGi hsa:55733.
UCSCi uc001hhz.4. human. [Q5VTY9-1 ]
uc009xcy.3. human. [Q5VTY9-5 ]
uc010psq.2. human. [Q5VTY9-6 ]

Organism-specific databases

CTDi 55733.
GeneCardsi GC01P210501.
HGNCi HGNC:18270. HHAT.
HPAi HPA016462.
MIMi 605743. gene.
neXtProti NX_Q5VTY9.
Orphaneti 1422. Chondrodysplasia - disorder of sex development.
PharmGKBi PA134926499.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1696.
GeneTreei ENSGT00530000063629.
HOGENOMi HOG000015758.
HOVERGENi HBG106485.
InParanoidi Q5VTY9.
OMAi QIDSDST.
OrthoDBi EOG7JT6W2.
PhylomeDBi Q5VTY9.
TreeFami TF315826.

Enzyme and pathway databases

SignaLinki Q5VTY9.

Miscellaneous databases

GenomeRNAii 55733.
NextBioi 35480853.
PROi Q5VTY9.
SOURCEi Search...

Gene expression databases

Bgeei Q5VTY9.
CleanExi HS_HHAT.
ExpressionAtlasi Q5VTY9. baseline and differential.
Genevestigatori Q5VTY9.

Family and domain databases

InterProi IPR004299. MBOAT_fam.
[Graphical view ]
Pfami PF03062. MBOAT. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation of a new melanoma antigen, MART-2, containing a mutated epitope recognized by autologous tumor-infiltrating T lymphocytes."
    Kawakami Y., Wang X., Shofuda T., Sumimoto H., Tupesis J., Fitzgerald E., Rosenberg S.
    J. Immunol. 166:2871-2877(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), TISSUE SPECIFICITY, GTP-BINDING, CHARACTERIZATION OF VARIANT GLU-448, VARIANT SER-450.
    Tissue: Melanoma.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 5; 6 AND 7), VARIANT ARG-188.
    Tissue: Brain, Lung, Teratocarcinoma, Testis and Trachea.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Brain cortex.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASN-182.
    Tissue: Brain and Testis.
  7. Rhodes S.
    Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 32-335 (ISOFORM 2).
  8. "Skinny hedgehog, an acyltransferase required for palmitoylation and activity of the hedgehog signal."
    Chamoun Z., Mann R.K., Nellen D., von Kessler D.P., Bellotto M., Beachy P.A., Basler K.
    Science 293:2080-2084(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 328-390 (ISOFORM 1).

Entry informationi

Entry nameiHHAT_HUMAN
AccessioniPrimary (citable) accession number: Q5VTY9
Secondary accession number(s): B7Z4D5
, B7Z5I1, B7Z868, B7ZA75, D3DT91, F5H444, Q17RZ7, Q4G0K3, Q5CZ95, Q5TGI2, Q9NVH9, Q9Y3N8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 20, 2005
Last sequence update: December 7, 2004
Last modified: October 29, 2014
This is version 98 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3