Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5VTY9

- HHAT_HUMAN

UniProt

Q5VTY9 - HHAT_HUMAN

Protein

Protein-cysteine N-palmitoyltransferase HHAT

Gene

HHAT

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 97 (01 Oct 2014)
      Sequence version 1 (07 Dec 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalyzes N-terminal palmitoylation of SHH; which is required for SHH signaling By similarity. May bind GTP.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei379 – 3791Sequence Analysis

    GO - Molecular functioni

    1. GTP binding Source: UniProtKB-KW
    2. palmitoyltransferase activity Source: Ensembl

    GO - Biological processi

    1. multicellular organismal development Source: UniProtKB-KW
    2. protein palmitoylation Source: Ensembl
    3. smoothened signaling pathway Source: Ensembl

    Keywords - Molecular functioni

    Acyltransferase, Developmental protein, Transferase

    Keywords - Ligandi

    GTP-binding, Nucleotide-binding

    Enzyme and pathway databases

    SignaLinkiQ5VTY9.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein-cysteine N-palmitoyltransferase HHAT (EC:2.3.1.-)
    Alternative name(s):
    Hedgehog acyltransferase
    Melanoma antigen recognized by T-cells 2
    Short name:
    MART-2
    Skinny hedgehog protein 1
    Gene namesi
    Name:HHAT
    Synonyms:MART2, SKI1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:18270. HHAT.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum membrane Source: UniProtKB-SubCell
    2. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134926499.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 493493Protein-cysteine N-palmitoyltransferase HHATPRO_0000213134Add
    BLAST

    Proteomic databases

    PRIDEiQ5VTY9.

    PTM databases

    PhosphoSiteiQ5VTY9.

    Expressioni

    Tissue specificityi

    Ubiquitously expressed in normal tissues and cancer cell lines.1 Publication

    Gene expression databases

    ArrayExpressiQ5VTY9.
    BgeeiQ5VTY9.
    CleanExiHS_HHAT.
    GenevestigatoriQ5VTY9.

    Organism-specific databases

    HPAiHPA016462.

    Interactioni

    Protein-protein interaction databases

    BioGridi120852. 1 interaction.
    STRINGi9606.ENSP00000261458.

    Structurei

    3D structure databases

    ProteinModelPortaliQ5VTY9.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei5 – 2521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei69 – 8921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei95 – 11521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei133 – 15220HelicalSequence AnalysisAdd
    BLAST
    Transmembranei200 – 22021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei251 – 27121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei290 – 31021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei360 – 38021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei429 – 44921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei467 – 48721HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni448 – 4558GTP-bindingCurated

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG1696.
    HOGENOMiHOG000015758.
    HOVERGENiHBG106485.
    OMAiQIDSDST.
    OrthoDBiEOG7JT6W2.
    PhylomeDBiQ5VTY9.
    TreeFamiTF315826.

    Family and domain databases

    InterProiIPR004299. MBOAT_fam.
    [Graphical view]
    PfamiPF03062. MBOAT. 1 hit.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5VTY9-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLPRWELALY LLASLGFHFY SFYEVYKVSR EHEEELDQEF ELETDTLFGG    50
    LKKDATDFEW SFWMEWGKQW LVWLLLGHMV VSQMATLLAR KHRPWILMLY 100
    GMWACWCVLG TPGVAMVLLH TTISFCVAQF RSQLLTWLCS LLLLSTLRLQ 150
    GVEEVKRRWY KTENEYYLLQ FTLTVRCLYY TSFSLELCWQ QLPAASTSYS 200
    FPWMLAYVFY YPVLHNGPIL SFSEFIKQMQ QQEHDSLKAS LCVLALGLGR 250
    LLCWWWLAEL MAHLMYMHAI YSSIPLLETV SCWTLGGLAL AQVLFFYVKY 300
    LVLFGVPALL MRLDGLTPPA LPRCVSTMFS FTGMWRYFDV GLHNFLIRYV 350
    YIPVGGSQHG LLGTLFSTAM TFAFVSYWHG GYDYLWCWAA LNWLGVTVEN 400
    GVRRLVETPC IQDSLARYFS PQARRRFHAA LASCSTSMLI LSNLVFLGGN 450
    EVGKTYWNRI FIQGWPWVTL SVLGFLYCYS HVGIAWAQTY ATD 493
    Length:493
    Mass (Da):57,313
    Last modified:December 7, 2004 - v1
    Checksum:i5E962E2A61F2DE15
    GO
    Isoform 2 (identifier: Q5VTY9-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         91-155: Missing.
         465-493: WPWVTLSVLGFLYCYSHVGIAWAQTYATD → GLFLFFLLNP...IENTSELSSY

    Show »
    Length:453
    Mass (Da):52,891
    Checksum:i83441A7D3EAE5A84
    GO
    Isoform 3 (identifier: Q5VTY9-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         465-493: WPWVTLSVLGFLYCYSHVGIAWAQTYATD → GLFLFFLLNP...IENTSELSSY

    Note: No experimental confirmation available.

    Show »
    Length:518
    Mass (Da):60,308
    Checksum:i9FDB3E0136FB3AFE
    GO
    Isoform 4 (identifier: Q5VTY9-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-369: Missing.
         416-451: ARYFSPQARRRFHAALASCSTSMLILSNLVFLGGNE → VSRILAPVLGDSGTRQIRFIRDGAIRFPAPTMGPFY
         452-493: Missing.

    Show »
    Length:82
    Mass (Da):9,328
    Checksum:iE6DA1D13019D20A2
    GO
    Isoform 5 (identifier: Q5VTY9-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         91-155: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:428
    Mass (Da):49,896
    Checksum:i0EDD316948355C70
    GO
    Isoform 6 (identifier: Q5VTY9-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         92-228: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:356
    Mass (Da):41,100
    Checksum:i7F78984C97B46E08
    GO
    Isoform 7 (identifier: Q5VTY9-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-30: MLPRWELALYLLASLGFHFYSFYEVYKVSR → MSLGLGSAERGVLGTRGARERCRRRRPGQPG

    Note: No experimental confirmation available.

    Show »
    Length:494
    Mass (Da):56,951
    Checksum:i52FA7301CED685EF
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti2 – 21L → P in BAA91772. (PubMed:14702039)Curated
    Sequence conflicti204 – 2041M → V in BAH14561. (PubMed:14702039)Curated
    Sequence conflicti450 – 4501N → D in BAA91772. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti165 – 1651E → G.
    Corresponds to variant rs2228898 [ dbSNP | Ensembl ].
    VAR_050024
    Natural varianti182 – 1821S → N.1 Publication
    Corresponds to variant rs2294851 [ dbSNP | Ensembl ].
    VAR_024743
    Natural varianti188 – 1881C → R.1 Publication
    Corresponds to variant rs34228541 [ dbSNP | Ensembl ].
    VAR_061336
    Natural varianti448 – 4481G → E in a melanoma cell line; abolishes GTP-binding.
    VAR_024744
    Natural varianti450 – 4501N → S in a lung cancer cell line. 1 Publication
    VAR_024745

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 369369Missing in isoform 4. 1 PublicationVSP_016685Add
    BLAST
    Alternative sequencei1 – 3030MLPRW…YKVSR → MSLGLGSAERGVLGTRGARE RCRRRRPGQPG in isoform 7. 1 PublicationVSP_044968Add
    BLAST
    Alternative sequencei91 – 15565Missing in isoform 2 and isoform 5. 3 PublicationsVSP_016686Add
    BLAST
    Alternative sequencei92 – 228137Missing in isoform 6. 1 PublicationVSP_043481Add
    BLAST
    Alternative sequencei416 – 45136ARYFS…LGGNE → VSRILAPVLGDSGTRQIRFI RDGAIRFPAPTMGPFY in isoform 4. 1 PublicationVSP_016687Add
    BLAST
    Alternative sequencei452 – 49342Missing in isoform 4. 1 PublicationVSP_016688Add
    BLAST
    Alternative sequencei465 – 49329WPWVT…TYATD → GLFLFFLLNPCWETAFQGFP VFLHFLQTEVLATFVPNYFS WNICIENTSELSSY in isoform 2 and isoform 3. 2 PublicationsVSP_016689Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK001586 mRNA. Translation: BAA91772.1.
    AK297193 mRNA. Translation: BAH12521.1.
    AK298991 mRNA. Translation: BAH12917.1.
    AK302955 mRNA. Translation: BAH13854.1.
    AK316190 mRNA. Translation: BAH14561.1.
    AK316524 mRNA. Translation: BAH14895.1.
    CR936628 mRNA. Translation: CAI56771.1.
    AL590653
    , AC096636, AL034351, AL035414, AL691441 Genomic DNA. Translation: CAH70523.1.
    AL034351 Genomic DNA. Translation: CAI23103.1.
    AL034351
    , AC096636, AL035414, AL590653, AL691441 Genomic DNA. Translation: CAI23104.1.
    AL035414
    , AC096636, AL034351, AL590653, AL691441 Genomic DNA. Translation: CAI22284.1.
    AL691441
    , AC096636, AL034351, AL035414, AL590653 Genomic DNA. Translation: CAI17039.1.
    BX255872 Genomic DNA. No translation available.
    CH471100 Genomic DNA. Translation: EAW93427.1.
    CH471100 Genomic DNA. Translation: EAW93428.1.
    CH471100 Genomic DNA. Translation: EAW93430.1.
    BC117130 mRNA. Translation: AAI17131.1.
    AL049848 mRNA. Translation: CAB42852.1.
    CCDSiCCDS1495.1. [Q5VTY9-1]
    CCDS53471.1. [Q5VTY9-7]
    CCDS53472.1. [Q5VTY9-5]
    CCDS53473.1. [Q5VTY9-6]
    RefSeqiNP_001116306.1. NM_001122834.3. [Q5VTY9-1]
    NP_001164035.1. NM_001170564.2. [Q5VTY9-6]
    NP_001164051.1. NM_001170580.2. [Q5VTY9-1]
    NP_001164058.1. NM_001170587.2. [Q5VTY9-7]
    NP_001164059.1. NM_001170588.2. [Q5VTY9-5]
    NP_060664.2. NM_018194.5. [Q5VTY9-1]
    UniGeneiHs.58650.

    Genome annotation databases

    EnsembliENST00000261458; ENSP00000261458; ENSG00000054392. [Q5VTY9-1]
    ENST00000367010; ENSP00000355977; ENSG00000054392. [Q5VTY9-1]
    ENST00000413764; ENSP00000416845; ENSG00000054392. [Q5VTY9-1]
    ENST00000537898; ENSP00000442625; ENSG00000054392. [Q5VTY9-5]
    ENST00000541565; ENSP00000444995; ENSG00000054392. [Q5VTY9-6]
    ENST00000545154; ENSP00000438468; ENSG00000054392. [Q5VTY9-7]
    GeneIDi55733.
    KEGGihsa:55733.
    UCSCiuc001hhz.4. human. [Q5VTY9-1]
    uc009xcy.3. human. [Q5VTY9-5]
    uc010psq.2. human. [Q5VTY9-6]

    Polymorphism databases

    DMDMi74747010.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK001586 mRNA. Translation: BAA91772.1 .
    AK297193 mRNA. Translation: BAH12521.1 .
    AK298991 mRNA. Translation: BAH12917.1 .
    AK302955 mRNA. Translation: BAH13854.1 .
    AK316190 mRNA. Translation: BAH14561.1 .
    AK316524 mRNA. Translation: BAH14895.1 .
    CR936628 mRNA. Translation: CAI56771.1 .
    AL590653
    , AC096636 , AL034351 , AL035414 , AL691441 Genomic DNA. Translation: CAH70523.1 .
    AL034351 Genomic DNA. Translation: CAI23103.1 .
    AL034351
    , AC096636 , AL035414 , AL590653 , AL691441 Genomic DNA. Translation: CAI23104.1 .
    AL035414
    , AC096636 , AL034351 , AL590653 , AL691441 Genomic DNA. Translation: CAI22284.1 .
    AL691441
    , AC096636 , AL034351 , AL035414 , AL590653 Genomic DNA. Translation: CAI17039.1 .
    BX255872 Genomic DNA. No translation available.
    CH471100 Genomic DNA. Translation: EAW93427.1 .
    CH471100 Genomic DNA. Translation: EAW93428.1 .
    CH471100 Genomic DNA. Translation: EAW93430.1 .
    BC117130 mRNA. Translation: AAI17131.1 .
    AL049848 mRNA. Translation: CAB42852.1 .
    CCDSi CCDS1495.1. [Q5VTY9-1 ]
    CCDS53471.1. [Q5VTY9-7 ]
    CCDS53472.1. [Q5VTY9-5 ]
    CCDS53473.1. [Q5VTY9-6 ]
    RefSeqi NP_001116306.1. NM_001122834.3. [Q5VTY9-1 ]
    NP_001164035.1. NM_001170564.2. [Q5VTY9-6 ]
    NP_001164051.1. NM_001170580.2. [Q5VTY9-1 ]
    NP_001164058.1. NM_001170587.2. [Q5VTY9-7 ]
    NP_001164059.1. NM_001170588.2. [Q5VTY9-5 ]
    NP_060664.2. NM_018194.5. [Q5VTY9-1 ]
    UniGenei Hs.58650.

    3D structure databases

    ProteinModelPortali Q5VTY9.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120852. 1 interaction.
    STRINGi 9606.ENSP00000261458.

    PTM databases

    PhosphoSitei Q5VTY9.

    Polymorphism databases

    DMDMi 74747010.

    Proteomic databases

    PRIDEi Q5VTY9.

    Protocols and materials databases

    DNASUi 55733.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000261458 ; ENSP00000261458 ; ENSG00000054392 . [Q5VTY9-1 ]
    ENST00000367010 ; ENSP00000355977 ; ENSG00000054392 . [Q5VTY9-1 ]
    ENST00000413764 ; ENSP00000416845 ; ENSG00000054392 . [Q5VTY9-1 ]
    ENST00000537898 ; ENSP00000442625 ; ENSG00000054392 . [Q5VTY9-5 ]
    ENST00000541565 ; ENSP00000444995 ; ENSG00000054392 . [Q5VTY9-6 ]
    ENST00000545154 ; ENSP00000438468 ; ENSG00000054392 . [Q5VTY9-7 ]
    GeneIDi 55733.
    KEGGi hsa:55733.
    UCSCi uc001hhz.4. human. [Q5VTY9-1 ]
    uc009xcy.3. human. [Q5VTY9-5 ]
    uc010psq.2. human. [Q5VTY9-6 ]

    Organism-specific databases

    CTDi 55733.
    GeneCardsi GC01P210501.
    HGNCi HGNC:18270. HHAT.
    HPAi HPA016462.
    MIMi 605743. gene.
    neXtProti NX_Q5VTY9.
    PharmGKBi PA134926499.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1696.
    HOGENOMi HOG000015758.
    HOVERGENi HBG106485.
    OMAi QIDSDST.
    OrthoDBi EOG7JT6W2.
    PhylomeDBi Q5VTY9.
    TreeFami TF315826.

    Enzyme and pathway databases

    SignaLinki Q5VTY9.

    Miscellaneous databases

    GenomeRNAii 55733.
    NextBioi 35480853.
    PROi Q5VTY9.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q5VTY9.
    Bgeei Q5VTY9.
    CleanExi HS_HHAT.
    Genevestigatori Q5VTY9.

    Family and domain databases

    InterProi IPR004299. MBOAT_fam.
    [Graphical view ]
    Pfami PF03062. MBOAT. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation of a new melanoma antigen, MART-2, containing a mutated epitope recognized by autologous tumor-infiltrating T lymphocytes."
      Kawakami Y., Wang X., Shofuda T., Sumimoto H., Tupesis J., Fitzgerald E., Rosenberg S.
      J. Immunol. 166:2871-2877(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), TISSUE SPECIFICITY, GTP-BINDING, CHARACTERIZATION OF VARIANT GLU-448, VARIANT SER-450.
      Tissue: Melanoma.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 5; 6 AND 7), VARIANT ARG-188.
      Tissue: Brain, Lung, Teratocarcinoma, Testis and Trachea.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Brain cortex.
    4. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASN-182.
      Tissue: Brain and Testis.
    7. Rhodes S.
      Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 32-335 (ISOFORM 2).
    8. "Skinny hedgehog, an acyltransferase required for palmitoylation and activity of the hedgehog signal."
      Chamoun Z., Mann R.K., Nellen D., von Kessler D.P., Bellotto M., Beachy P.A., Basler K.
      Science 293:2080-2084(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 328-390 (ISOFORM 1).

    Entry informationi

    Entry nameiHHAT_HUMAN
    AccessioniPrimary (citable) accession number: Q5VTY9
    Secondary accession number(s): B7Z4D5
    , B7Z5I1, B7Z868, B7ZA75, D3DT91, F5H444, Q17RZ7, Q4G0K3, Q5CZ95, Q5TGI2, Q9NVH9, Q9Y3N8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 20, 2005
    Last sequence update: December 7, 2004
    Last modified: October 1, 2014
    This is version 97 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3