Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myomesin-3

Gene

MYOM3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

May link the intermediate filament cytoskeleton to the M-disk of the myofibrils in striated muscle.By similarity

GO - Molecular functioni

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Myomesin-3
Alternative name(s):
Myomesin family member 3
Gene namesi
Name:MYOM3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:26679. MYOM3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134899390.

Polymorphism and mutation databases

BioMutaiMYOM3.
DMDMi74762257.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 14371437Myomesin-3PRO_0000315394Add
BLAST

Proteomic databases

PaxDbiQ5VTT5.
PRIDEiQ5VTT5.

PTM databases

iPTMnetiQ5VTT5.
PhosphoSiteiQ5VTT5.

Expressioni

Gene expression databases

BgeeiQ5VTT5.
CleanExiHS_MYOM3.
GenevisibleiQ5VTT5. HS.

Organism-specific databases

HPAiHPA028132.
HPA029752.

Interactioni

Subunit structurei

Homodimer.By similarity

GO - Molecular functioni

Protein-protein interaction databases

IntActiQ5VTT5. 2 interactions.
STRINGi9606.ENSP00000363557.

Structurei

3D structure databases

ProteinModelPortaliQ5VTT5.
SMRiQ5VTT5. Positions 153-1425.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini154 – 24693Ig-like C2-type 1Add
BLAST
Domaini269 – 36193Ig-like C2-type 2Add
BLAST
Domaini375 – 46995Fibronectin type-III 1PROSITE-ProRule annotationAdd
BLAST
Domaini503 – 59896Fibronectin type-III 2PROSITE-ProRule annotationAdd
BLAST
Domaini604 – 69693Fibronectin type-III 3PROSITE-ProRule annotationAdd
BLAST
Domaini702 – 79796Fibronectin type-III 4PROSITE-ProRule annotationAdd
BLAST
Domaini804 – 89996Fibronectin type-III 5PROSITE-ProRule annotationAdd
BLAST
Domaini1120 – 120586Ig-like C2-type 3Add
BLAST
Domaini1334 – 142390Ig-like C2-type 4Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili120 – 14930Sequence analysisAdd
BLAST

Sequence similaritiesi

Contains 5 fibronectin type-III domains.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Immunoglobulin domain, Repeat

Phylogenomic databases

eggNOGiENOG410IJ5G. Eukaryota.
ENOG410ZSRR. LUCA.
GeneTreeiENSGT00840000129736.
HOVERGENiHBG004977.
InParanoidiQ5VTT5.
OMAiFAREKEP.
OrthoDBiEOG7B31M0.
PhylomeDBiQ5VTT5.
TreeFamiTF331825.

Family and domain databases

Gene3Di2.60.40.10. 11 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013151. Immunoglobulin.
[Graphical view]
PfamiPF00041. fn3. 5 hits.
PF07679. I-set. 3 hits.
PF00047. ig. 1 hit.
[Graphical view]
SMARTiSM00060. FN3. 5 hits.
SM00409. IG. 5 hits.
SM00408. IGc2. 3 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 6 hits.
SSF49265. SSF49265. 3 hits.
PROSITEiPS50853. FN3. 5 hits.
PS50835. IG_LIKE. 4 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5VTT5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTLPHSLGGA GDPRPPQAME VHRLEHRQEE EQKEERQHSL RMGSSVRRRT
60 70 80 90 100
FRSSEEEHEF SAADYALAAA LALTASSELS WEAQLRRQTS AVELEERGQK
110 120 130 140 150
RVGFGNDWER TEIAFLQTHR LLRQRRDWKT LRRRTEEKVQ EAKELRELCY
160 170 180 190 200
GRGPWFWIPL RSHAVWEHTT VLLTCTVQAS PPPQVTWYKN DTRIDPRLFR
210 220 230 240 250
AGKYRITNNY GLLSLEIRRC AIEDSATYTV RVKNAHGQAS SFAKVLVRTY
260 270 280 290 300
LGKDAGFDSE IFKRSTFGPS VEFTSVLKPV FAREKEPFSL SCLFSEDVLD
310 320 330 340 350
AESIQWFRDG SLLRSSRRRK ILYTDRQASL KVSCTYKEDE GLYMVRVPSP
360 370 380 390 400
FGPREQSTYV LVRDAEAENP GAPGSPLNVR CLDVNRDCLI LTWAPPSDTR
410 420 430 440 450
GNPITAYTIE RCQGESGEWI ACHEAPGGTC RCPIQGLVEG QSYRFRVRAI
460 470 480 490 500
SRVGSSVPSK ASELVVMGDH DAARRKTEIP FDLGNKITIS TDAFEDTVTI
510 520 530 540 550
PSPPTNVHAS EIREAYVVLA WEEPSPRDRA PLTYSLEKSV IGSGTWEAIS
560 570 580 590 600
SESPVRSPRF AVLDLEKKKS YVFRVRAMNQ YGLSDPSEPS EPIALRGPPA
610 620 630 640 650
TLPPPAQVQA FRDTQTSVSL TWDPVKDPEL LGYYIYSRKV GTSEWQTVNN
660 670 680 690 700
KPIQGTRFTV PGLRTGKEYE FCVRSVSEAG VGESSAATEP IRVKQALATP
710 720 730 740 750
SAPYGFALLN CGKNEMVIGW KPPKRRGGGK ILGYFLDQHD SEELDWHAVN
760 770 780 790 800
QQPIPTRVCK VSDLHEGHFY EFRARAANWA GVGELSAPSS LFECKEWTMP
810 820 830 840 850
QPGPPYDVRA SEVRATSLVL QWEPPLYMGA GPVTGYHVSF QEEGSEQWKP
860 870 880 890 900
VTPGPISGTH LRVSDLQPGK SYVFQVQAMN SAGLGQPSMP TDPVLLEDKP
910 920 930 940 950
GAHEIEVGVD EEGFIYLAFE APEAPDSSEF QWSKDYKGPL DPQRVKIEDK
960 970 980 990 1000
VNKSKVILKE PGLEDLGTYS VIVTDADEDI SASHTLTEEE LEKLKKLSHE
1010 1020 1030 1040 1050
IRNPVIKLIS GWNIDILERG EVRLWLEVEK LSPAAELHLI FNNKEIFSSP
1060 1070 1080 1090 1100
NRKINFDREK GLVEVIIQNL SEEDKGSYTA QLQDGKAKNQ ITLTLVDDDF
1110 1120 1130 1140 1150
DKLLRKADAK RRDWKRKQGP YFERPLQWKV TEDCQVQLTC KVTNTKKETR
1160 1170 1180 1190 1200
FQWFFQRAEM PDGQYDPETG TGLLCIEELS KKDKGIYRAM VSDDRGEDDT
1210 1220 1230 1240 1250
ILDLTGDALD AIFTELGRIG ALSATPLKIQ GTEEGIRIFS KVKYYNVEYM
1260 1270 1280 1290 1300
KTTWFHKDKR LESGDRIRTG TTLDEIWLHI LDPKDSDKGK YTLEIAAGKE
1310 1320 1330 1340 1350
VRQLSTDLSG QAFEDAMAEH QRLKTLAIIE KNRAKVVRGL PDVATIMEDK
1360 1370 1380 1390 1400
TLCLTCIVSG DPTPEISWLK NDQPVTFLDR YRMEVRGTEV TITIEKVNSE
1410 1420 1430
DSGRYGVFVK NKYGSETGQV TISVFKHGDE PKELKSM
Length:1,437
Mass (Da):162,189
Last modified:December 7, 2004 - v1
Checksum:i0025DEF2965AA001
GO
Isoform 2 (identifier: Q5VTT5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1179-1212: LSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAI → ASVAPASGLTFSFGCKPGRAKSSGLGVRAGPRLG
     1213-1437: Missing.

Show »
Length:1,212
Mass (Da):136,277
Checksum:i933DEC9AA0D4129A
GO
Isoform 3 (identifier: Q5VTT5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1107: Missing.
     1108-1141: DAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCK → MDISKKNRVRQGSRGRGKTISKNSESRGQQRRHM

Show »
Length:330
Mass (Da):37,475
Checksum:iEF25151C886E9780
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1083 – 10831Q → R in BAC87343 (PubMed:14702039).Curated
Sequence conflicti1246 – 12461N → D in CAH10376 (PubMed:17974005).Curated
Sequence conflicti1344 – 13441A → T in CAH10376 (PubMed:17974005).Curated
Sequence conflicti1350 – 13501K → R in BAC04119 (PubMed:14702039).Curated
Sequence conflicti1414 – 14141G → V in BAC04119 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti258 – 2581D → H.1 Publication
Corresponds to variant rs4319261 [ dbSNP | Ensembl ].
VAR_049910
Natural varianti266 – 2661T → M.2 Publications
Corresponds to variant rs6678540 [ dbSNP | Ensembl ].
VAR_038179
Natural varianti344 – 3441M → T.2 Publications
Corresponds to variant rs4233050 [ dbSNP | Ensembl ].
VAR_038180
Natural varianti435 – 4351Q → R.1 Publication
Corresponds to variant rs6700245 [ dbSNP | Ensembl ].
VAR_038181
Natural varianti528 – 5281D → G.3 Publications
Corresponds to variant rs4393101 [ dbSNP | Ensembl ].
VAR_038182
Natural varianti662 – 6621G → R.2 Publications
Corresponds to variant rs4320729 [ dbSNP | Ensembl ].
VAR_038183
Natural varianti775 – 7751R → Q.
Corresponds to variant rs12082295 [ dbSNP | Ensembl ].
VAR_038184
Natural varianti853 – 8531P → S.1 Publication
Corresponds to variant rs35446243 [ dbSNP | Ensembl ].
VAR_038185
Natural varianti892 – 8921D → A.
Corresponds to variant rs36077733 [ dbSNP | Ensembl ].
VAR_038186
Natural varianti1041 – 10411F → L.
Corresponds to variant rs16829083 [ dbSNP | Ensembl ].
VAR_038187
Natural varianti1066 – 10661I → T.
Corresponds to variant rs12145360 [ dbSNP | Ensembl ].
VAR_038188
Natural varianti1124 – 11241R → Q.1 Publication
Corresponds to variant rs16829071 [ dbSNP | Ensembl ].
VAR_038189

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11071107Missing in isoform 3. 1 PublicationVSP_030542Add
BLAST
Alternative sequencei1108 – 114134DAKRR…QLTCK → MDISKKNRVRQGSRGRGKTI SKNSESRGQQRRHM in isoform 3. 1 PublicationVSP_030543Add
BLAST
Alternative sequencei1179 – 121234LSKKD…ALDAI → ASVAPASGLTFSFGCKPGRA KSSGLGVRAGPRLG in isoform 2. 1 PublicationVSP_030544Add
BLAST
Alternative sequencei1213 – 1437225Missing in isoform 2. 1 PublicationVSP_030545Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK093280 mRNA. Translation: BAC04119.1.
AK128233 mRNA. Translation: BAC87343.1.
AL591178 Genomic DNA. Translation: CAH72089.1.
AL591178 Genomic DNA. Translation: CAH72090.1.
CH471134 Genomic DNA. Translation: EAW95108.1.
BC014671 mRNA. Translation: AAH14671.1.
BC067101 mRNA. Translation: AAH67101.1.
BX537911 mRNA. Translation: CAD97895.1.
BX647453 mRNA. Translation: CAH10377.1.
BX647455 mRNA. Translation: CAH10376.1.
CCDSiCCDS41281.1. [Q5VTT5-1]
RefSeqiNP_689585.3. NM_152372.3. [Q5VTT5-1]
UniGeneiHs.523413.

Genome annotation databases

EnsembliENST00000338909; ENSP00000342689; ENSG00000142661. [Q5VTT5-3]
ENST00000374434; ENSP00000363557; ENSG00000142661. [Q5VTT5-1]
GeneIDi127294.
KEGGihsa:127294.
UCSCiuc001bil.5. human. [Q5VTT5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK093280 mRNA. Translation: BAC04119.1.
AK128233 mRNA. Translation: BAC87343.1.
AL591178 Genomic DNA. Translation: CAH72089.1.
AL591178 Genomic DNA. Translation: CAH72090.1.
CH471134 Genomic DNA. Translation: EAW95108.1.
BC014671 mRNA. Translation: AAH14671.1.
BC067101 mRNA. Translation: AAH67101.1.
BX537911 mRNA. Translation: CAD97895.1.
BX647453 mRNA. Translation: CAH10377.1.
BX647455 mRNA. Translation: CAH10376.1.
CCDSiCCDS41281.1. [Q5VTT5-1]
RefSeqiNP_689585.3. NM_152372.3. [Q5VTT5-1]
UniGeneiHs.523413.

3D structure databases

ProteinModelPortaliQ5VTT5.
SMRiQ5VTT5. Positions 153-1425.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ5VTT5. 2 interactions.
STRINGi9606.ENSP00000363557.

PTM databases

iPTMnetiQ5VTT5.
PhosphoSiteiQ5VTT5.

Polymorphism and mutation databases

BioMutaiMYOM3.
DMDMi74762257.

Proteomic databases

PaxDbiQ5VTT5.
PRIDEiQ5VTT5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338909; ENSP00000342689; ENSG00000142661. [Q5VTT5-3]
ENST00000374434; ENSP00000363557; ENSG00000142661. [Q5VTT5-1]
GeneIDi127294.
KEGGihsa:127294.
UCSCiuc001bil.5. human. [Q5VTT5-1]

Organism-specific databases

CTDi127294.
GeneCardsiMYOM3.
H-InvDBHIX0199897.
HGNCiHGNC:26679. MYOM3.
HPAiHPA028132.
HPA029752.
neXtProtiNX_Q5VTT5.
PharmGKBiPA134899390.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJ5G. Eukaryota.
ENOG410ZSRR. LUCA.
GeneTreeiENSGT00840000129736.
HOVERGENiHBG004977.
InParanoidiQ5VTT5.
OMAiFAREKEP.
OrthoDBiEOG7B31M0.
PhylomeDBiQ5VTT5.
TreeFamiTF331825.

Miscellaneous databases

GenomeRNAii127294.
PROiQ5VTT5.

Gene expression databases

BgeeiQ5VTT5.
CleanExiHS_MYOM3.
GenevisibleiQ5VTT5. HS.

Family and domain databases

Gene3Di2.60.40.10. 11 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013151. Immunoglobulin.
[Graphical view]
PfamiPF00041. fn3. 5 hits.
PF07679. I-set. 3 hits.
PF00047. ig. 1 hit.
[Graphical view]
SMARTiSM00060. FN3. 5 hits.
SM00409. IG. 5 hits.
SM00408. IGc2. 3 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 6 hits.
SSF49265. SSF49265. 3 hits.
PROSITEiPS50853. FN3. 5 hits.
PS50835. IG_LIKE. 4 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 266-1437 (ISOFORM 1), VARIANTS MET-266; THR-344; ARG-435; GLY-528 AND ARG-662.
    Tissue: Testis.
  2. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS GLY-528 AND GLN-1124.
    Tissue: Brain and Colon.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-1401 (ISOFORM 1), VARIANTS HIS-258; MET-266; THR-344; GLY-528; ARG-662 AND SER-853.
    Tissue: Skeletal muscle.

Entry informationi

Entry nameiMYOM3_HUMAN
AccessioniPrimary (citable) accession number: Q5VTT5
Secondary accession number(s): A6NF75
, Q5VTT6, Q6AWC0, Q6AWC1, Q6NXF9, Q6ZRG7, Q7Z3G9, Q8NA11, Q96C54
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: December 7, 2004
Last modified: June 8, 2016
This is version 103 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.