Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 9

Gene

AGAP9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Protein inferred from homologyi

Functioni

Putative GTPase-activating protein.Curated

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri524 – 54724C4-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 9
Short name:
AGAP-9
Alternative name(s):
Centaurin-gamma-like family member 6
Gene namesi
Name:AGAP9
Synonyms:CTGLF6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:23463. AGAP9.

Pathology & Biotechi

Polymorphism and mutation databases

DMDMi145558891.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 703703Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 9PRO_0000284677Add
BLAST

Proteomic databases

EPDiQ5VTM2.
PaxDbiQ5VTM2.
PRIDEiQ5VTM2.

PTM databases

PhosphoSiteiQ5VTM2.

Expressioni

Gene expression databases

BgeeiQ5VTM2.
CleanExiHS_AGAP9.
GenevisibleiQ5VTM2. HS.

Organism-specific databases

HPAiHPA042490.

Interactioni

Protein-protein interaction databases

IntActiQ5VTM2. 1 interaction.
STRINGi9606.ENSP00000407436.

Structurei

3D structure databases

ProteinModelPortaliQ5VTM2.
SMRiQ5VTM2. Positions 325-492, 515-673.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini327 – 488162PHPROSITE-ProRule annotationAdd
BLAST
Domaini509 – 629121Arf-GAPPROSITE-ProRule annotationAdd
BLAST
Repeati631 – 70070ANKAdd
BLAST

Sequence similaritiesi

Belongs to the centaurin gamma-like family.Curated
Contains 1 ANK repeat.Curated
Contains 1 Arf-GAP domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri524 – 54724C4-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

ANK repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG0705. Eukaryota.
KOG1951. Eukaryota.
COG5192. LUCA.
COG5347. LUCA.
GeneTreeiENSGT00760000118874.
HOGENOMiHOG000007233.
HOVERGENiHBG054045.
InParanoidiQ5VTM2.
OMAiLMCIERS.
OrthoDBiEOG72VH5V.
PhylomeDBiQ5VTM2.
TreeFamiTF317762.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
2.30.29.30. 2 hits.
3.40.50.300. 1 hit.
InterProiIPR020683. Ankyrin_rpt-contain_dom.
IPR001164. ArfGAP.
IPR027417. P-loop_NTPase.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PfamiPF01412. ArfGap. 1 hit.
[Graphical view]
PRINTSiPR00405. REVINTRACTNG.
SMARTiSM00105. ArfGap. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50115. ARFGAP. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5VTM2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFEDVFSDSG NTGNFDRGKK RRLTIIECGC DINMMIDLAK VADLVLMLID
60 70 80 90 100
ASFGFEMEMF EFLNICQAHG FPKILGVLTH LDSFKHNKQL KKTKKRLKHR
110 120 130 140 150
FWTEVYQDKV GLTHELVQSL ISTYSTIDAK MASSRVTLLS NSKPLGSEAI
160 170 180 190 200
DNQGVSLEFD QQQGSVCPSE SEIYEAGAED RMAGAPMAAA VQPAEVTVEV
210 220 230 240 250
GEDLHMHQVR DREMPEVVEI RRSNCTNHCD LGDTSSYHTK VSTVHIMKKR
260 270 280 290 300
NGGGSLNNYS SSIPPTPSTS QEDPQFSVPP TANTPTPVCK RSMRWSNLFT
310 320 330 340 350
SEKGSDPDKE RKAPENHADT IGSGRAIPIK QGMLLKRSGK WLKTWKKKYV
360 370 380 390 400
TLCSNGVLTY YSSLGDYMKN IHKKEIDLRT STIKVPGKWP SLATSACAPI
410 420 430 440 450
SSSKSNGLSK DMDTGLGDSI CFSPGISSTT SPKLNPPPSP HANKKKHLKK
460 470 480 490 500
KSTNNFMIVS ATGQTWHFEA TTYEERDAWV QAIQSQILAS LQSCKSSKSK
510 520 530 540 550
SQLTSQSEAM ALQSIQNMRG NAHCVDCETQ NPKWASLNLG VLMCIECSGI
560 570 580 590 600
HRSFGTRLSR VRSLELDDWP VELRKVMSSI GNELANSIWE GSSQGQTKPS
610 620 630 640 650
IKSTREEKEW WIRSKYEEKL FLAPLPCTEL SLGQQLLRAT TDEDLQTAIL
660 670 680 690 700
LLAHGSREEV NETCGEGDGC TALHLACRKG NVVLEQLLTG WTSWPEMPTG

TQR
Length:703
Mass (Da):77,972
Last modified:April 17, 2007 - v2
Checksum:i28D84F589E15A0EB
GO
Isoform 2 (identifier: Q5VTM2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-154: MFEDVFSDSG...LGSEAIDNQG → MGNILTCRVHPS
     216-216: E → EALEFNLSANPEASTIFQRNSQTDALEFNSSANPEASTIFQRNSQTD
     229-240: CDLGDTSSYHTK → VSTERFSQQYSSCSTIFLDDSTAIQHYLTMTIISVTLEIPHHITQRDADRSLSIPDEQLHSFA

Note: No experimental confirmation available.
Show »
Length:658
Mass (Da):72,750
Checksum:iCEA1E89921371BA5
GO

Sequence cautioni

The sequence CAH72201.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti495 – 4951K → E in BC171845 (PubMed:15489334).Curated
Sequence conflicti508 – 5081E → K in BC171845 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 154154MFEDV…IDNQG → MGNILTCRVHPS in isoform 2. 1 PublicationVSP_044549Add
BLAST
Alternative sequencei216 – 2161E → EALEFNLSANPEASTIFQRN SQTDALEFNSSANPEASTIF QRNSQTD in isoform 2. 1 PublicationVSP_044550
Alternative sequencei229 – 24012CDLGD…SYHTK → VSTERFSQQYSSCSTIFLDD STAIQHYLTMTIISVTLEIP HHITQRDADRSLSIPDEQLH SFA in isoform 2. 1 PublicationVSP_044551Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL591684 Genomic DNA. Translation: CAH72201.1. Sequence problems.
BC171845 Genomic DNA. No translation available.
CCDSiCCDS73125.1. [Q5VTM2-2]
RefSeqiNP_001177739.1. NM_001190810.1. [Q5VTM2-2]
UniGeneiHs.645346.
Hs.742298.

Genome annotation databases

EnsembliENST00000452145; ENSP00000392206; ENSG00000204172. [Q5VTM2-2]
GeneIDi642517.
KEGGihsa:642517.
UCSCiuc057tbu.1. human. [Q5VTM2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL591684 Genomic DNA. Translation: CAH72201.1. Sequence problems.
BC171845 Genomic DNA. No translation available.
CCDSiCCDS73125.1. [Q5VTM2-2]
RefSeqiNP_001177739.1. NM_001190810.1. [Q5VTM2-2]
UniGeneiHs.645346.
Hs.742298.

3D structure databases

ProteinModelPortaliQ5VTM2.
SMRiQ5VTM2. Positions 325-492, 515-673.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ5VTM2. 1 interaction.
STRINGi9606.ENSP00000407436.

PTM databases

PhosphoSiteiQ5VTM2.

Polymorphism and mutation databases

DMDMi145558891.

Proteomic databases

EPDiQ5VTM2.
PaxDbiQ5VTM2.
PRIDEiQ5VTM2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000452145; ENSP00000392206; ENSG00000204172. [Q5VTM2-2]
GeneIDi642517.
KEGGihsa:642517.
UCSCiuc057tbu.1. human. [Q5VTM2-1]

Organism-specific databases

CTDi642517.
GeneCardsiAGAP9.
HGNCiHGNC:23463. AGAP9.
HPAiHPA042490.
neXtProtiNX_Q5VTM2.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0705. Eukaryota.
KOG1951. Eukaryota.
COG5192. LUCA.
COG5347. LUCA.
GeneTreeiENSGT00760000118874.
HOGENOMiHOG000007233.
HOVERGENiHBG054045.
InParanoidiQ5VTM2.
OMAiLMCIERS.
OrthoDBiEOG72VH5V.
PhylomeDBiQ5VTM2.
TreeFamiTF317762.

Miscellaneous databases

ChiTaRSiAGAP9. human.
GenomeRNAii642517.
NextBioi113868.
PROiQ5VTM2.

Gene expression databases

BgeeiQ5VTM2.
CleanExiHS_AGAP9.
GenevisibleiQ5VTM2. HS.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
2.30.29.30. 2 hits.
3.40.50.300. 1 hit.
InterProiIPR020683. Ankyrin_rpt-contain_dom.
IPR001164. ArfGAP.
IPR027417. P-loop_NTPase.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PfamiPF01412. ArfGap. 1 hit.
[Graphical view]
PRINTSiPR00405. REVINTRACTNG.
SMARTiSM00105. ArfGap. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50115. ARFGAP. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.

Entry informationi

Entry nameiAGAP9_HUMAN
AccessioniPrimary (citable) accession number: Q5VTM2
Secondary accession number(s): D3YTF3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: April 17, 2007
Last modified: March 16, 2016
This is version 99 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Encoded by one of the numerous copies of centaurin gamma-like genes clustered in the q11 region of chromosome 10.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.