Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Annexin A8-like protein 1

Gene

ANXA8L1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi266 – 2661Calcium; via carbonyl oxygenBy similarity
Metal bindingi268 – 2681Calcium; via carbonyl oxygenBy similarity
Metal bindingi270 – 2701Calcium; via carbonyl oxygenBy similarity
Metal bindingi310 – 3101CalciumBy similarity

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

Calcium, Calcium/phospholipid-binding, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Annexin A8-like protein 1Curated
Gene namesi
Name:ANXA8L1Imported
Synonyms:ANXA8L2Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:23334. ANXA8L1.

Subcellular locationi

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134927491.

Polymorphism and mutation databases

DMDMi74756781.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 327327Annexin A8-like protein 1PRO_0000328939Add
BLAST

Proteomic databases

EPDiQ5VT79.
MaxQBiQ5VT79.
PaxDbiQ5VT79.
PRIDEiQ5VT79.

PTM databases

iPTMnetiQ5VT79.
PhosphoSiteiQ5VT79.

Expressioni

Gene expression databases

BgeeiQ5VT79.
CleanExiHS_ANXA8L2.
ExpressionAtlasiQ5VT79. baseline and differential.

Interactioni

Protein-protein interaction databases

BioGridi608549. 8 interactions.
MINTiMINT-5001440.
STRINGi9606.ENSP00000363395.

Structurei

3D structure databases

ProteinModelPortaliQ5VT79.
SMRiQ5VT79. Positions 17-327.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati25 – 9066Annexin 1Sequence analysisAdd
BLAST
Repeati97 – 16266Annexin 2Sequence analysisAdd
BLAST
Repeati181 – 24767Annexin 3Sequence analysisAdd
BLAST
Repeati257 – 32266Annexin 4Sequence analysisAdd
BLAST

Domaini

A pair of annexin repeats may form one binding site for calcium and phospholipid.By similarity

Sequence similaritiesi

Belongs to the annexin family.Sequence analysis
Contains 4 annexin repeats.Sequence analysis

Keywords - Domaini

Annexin, Repeat

Phylogenomic databases

eggNOGiKOG0819. Eukaryota.
ENOG410XPUN. LUCA.
GeneTreeiENSGT00760000118972.
HOGENOMiHOG000158803.
HOVERGENiHBG061815.
InParanoidiQ5VT79.
KOiK17096.
TreeFamiTF105452.

Family and domain databases

Gene3Di1.10.220.10. 4 hits.
InterProiIPR001464. Annexin.
IPR018502. Annexin_repeat.
IPR018252. Annexin_repeat_CS.
IPR009115. AnnexinVIII.
[Graphical view]
PfamiPF00191. Annexin. 4 hits.
[Graphical view]
PRINTSiPR00196. ANNEXIN.
PR01808. ANNEXINVIII.
SMARTiSM00335. ANX. 4 hits.
[Graphical view]
PROSITEiPS00223. ANNEXIN. 4 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q5VT79-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAWWKAWIEQ EGVTVKSSSH FNPDPDAETL YKAMKGIGTN EQAIIDVLTK
60 70 80 90 100
RSNTQRQQIA KSFKAQFGKD LTETLKSELS GKFERLIVAL MYPPYRYEAK
110 120 130 140 150
ELHDAMKGLG TKEGVIIEIL ASRTKNQLRE IMKAYEEDYG SSLEEDIQAD
160 170 180 190 200
TSGYLERILV CLLQGSRDDV SSFVDPALAL QDAQDLYAAG EKIRGTDEMK
210 220 230 240 250
FITILCTRSA THLLRVFEEY EKIANKSIED SIKSETHGSL EEAMLTVVKC
260 270 280 290 300
TQNLHSYFAE RLYYAMKGAG TRDGTLIRNI VSRSEIDLNL IKCHFKKMYG
310 320
KTLSSMIMED TSGDYKNALL SLVGSDP
Note: No experimental confirmation available.Curated
Length:327
Mass (Da):36,879
Last modified:July 22, 2015 - v2
Checksum:i3AAEE1D7072A9379
GO
Isoform 22 Publications (identifier: Q5VT79-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     38-38: G → GVGSQLLSHQAAAFAFPSSALTSVSPWGQQGHLCCNPAG
     109-165: Missing.
     217-248: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:276
Mass (Da):30,691
Checksum:i95FF53E36BA64F58
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti134 – 1341A → V.2 Publications
Corresponds to variant rs2271519 [ dbSNP | Ensembl ].
VAR_067447
Natural varianti177 – 1771A → G.
Corresponds to variant rs3013886 [ dbSNP | Ensembl ].
VAR_048254
Natural varianti192 – 1921K → N.1 Publication
Corresponds to variant rs977788 [ dbSNP | Ensembl ].
VAR_067448

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei38 – 381G → GVGSQLLSHQAAAFAFPSSA LTSVSPWGQQGHLCCNPAG in isoform 2. 2 PublicationsVSP_052782
Alternative sequencei109 – 16557Missing in isoform 2. 2 PublicationsVSP_052783Add
BLAST
Alternative sequencei217 – 24832Missing in isoform 2. 2 PublicationsVSP_052784Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK223149 mRNA. Translation: BAD96869.1.
AK313626 mRNA. Translation: BAG36386.1.
AC244230 Genomic DNA. No translation available.
AL603965 Genomic DNA. Translation: CAH70574.1.
AL603965 Genomic DNA. Translation: CAH70575.1.
AL732434 Genomic DNA. No translation available.
BC008813 mRNA. Translation: AAH08813.3.
CCDSiCCDS73097.1. [Q5VT79-2]
CCDS73098.1. [Q5VT79-1]
RefSeqiNP_001092315.2. NM_001098845.2. [Q5VT79-1]
NP_001265853.1. NM_001278924.1. [Q5VT79-2]
UniGeneiHs.705389.

Genome annotation databases

EnsembliENST00000619162; ENSP00000480221; ENSG00000264230. [Q5VT79-1]
ENST00000622769; ENSP00000483608; ENSG00000264230. [Q5VT79-2]
GeneIDi728113.
KEGGihsa:728113.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK223149 mRNA. Translation: BAD96869.1.
AK313626 mRNA. Translation: BAG36386.1.
AC244230 Genomic DNA. No translation available.
AL603965 Genomic DNA. Translation: CAH70574.1.
AL603965 Genomic DNA. Translation: CAH70575.1.
AL732434 Genomic DNA. No translation available.
BC008813 mRNA. Translation: AAH08813.3.
CCDSiCCDS73097.1. [Q5VT79-2]
CCDS73098.1. [Q5VT79-1]
RefSeqiNP_001092315.2. NM_001098845.2. [Q5VT79-1]
NP_001265853.1. NM_001278924.1. [Q5VT79-2]
UniGeneiHs.705389.

3D structure databases

ProteinModelPortaliQ5VT79.
SMRiQ5VT79. Positions 17-327.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi608549. 8 interactions.
MINTiMINT-5001440.
STRINGi9606.ENSP00000363395.

PTM databases

iPTMnetiQ5VT79.
PhosphoSiteiQ5VT79.

Polymorphism and mutation databases

DMDMi74756781.

Proteomic databases

EPDiQ5VT79.
MaxQBiQ5VT79.
PaxDbiQ5VT79.
PRIDEiQ5VT79.

Protocols and materials databases

DNASUi244.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000619162; ENSP00000480221; ENSG00000264230. [Q5VT79-1]
ENST00000622769; ENSP00000483608; ENSG00000264230. [Q5VT79-2]
GeneIDi728113.
KEGGihsa:728113.

Organism-specific databases

CTDi728113.
HGNCiHGNC:23334. ANXA8L1.
neXtProtiNX_Q5VT79.
PharmGKBiPA134927491.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0819. Eukaryota.
ENOG410XPUN. LUCA.
GeneTreeiENSGT00760000118972.
HOGENOMiHOG000158803.
HOVERGENiHBG061815.
InParanoidiQ5VT79.
KOiK17096.
TreeFamiTF105452.

Miscellaneous databases

GenomeRNAii728113.
NextBioi972.
PROiQ5VT79.

Gene expression databases

BgeeiQ5VT79.
CleanExiHS_ANXA8L2.
ExpressionAtlasiQ5VT79. baseline and differential.

Family and domain databases

Gene3Di1.10.220.10. 4 hits.
InterProiIPR001464. Annexin.
IPR018502. Annexin_repeat.
IPR018252. Annexin_repeat_CS.
IPR009115. AnnexinVIII.
[Graphical view]
PfamiPF00191. Annexin. 4 hits.
[Graphical view]
PRINTSiPR00196. ANNEXIN.
PR01808. ANNEXINVIII.
SMARTiSM00335. ANX. 4 hits.
[Graphical view]
PROSITEiPS00223. ANNEXIN. 4 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-134.
    Tissue: LungImported.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-134.
    Tissue: Trachea.
  3. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ASN-192.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: PlacentaImported.

Entry informationi

Entry nameiAXA81_HUMAN
AccessioniPrimary (citable) accession number: Q5VT79
Secondary accession number(s): A0A0B4J2D4
, B2R939, Q53FY2, Q5VT78, Q96H89
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: July 22, 2015
Last modified: April 13, 2016
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.