Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase MRCK alpha

Gene

CDC42BPA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Serine/threonine-protein kinase which is an important downstream effector of CDC42 and plays a role in the regulation of cytoskeleton reorganization and cell migration. Regulates actin cytoskeletal reorganization via phosphorylation of PPP1R12C and MYL9/MLC2. In concert with MYO18A and LURAP1, is involved in modulating lamellar actomyosin retrograde flow that is crucial to cell protrusion and migration. Phosphorylates: PPP1R12A, LIMK1 and LIMK2. May play a role in TFRC-mediated iron uptake.8 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.1 Publication

Cofactori

Mg2+1 Publication

Enzyme regulationi

Maintained in an inactive, closed conformation by an interaction between the kinase domain and the negative autoregulatory C-terminal coiled-coil region. Agonist binding to the phorbol ester binding site disrupts this, releasing the kinase domain to allow N-terminus-mediated dimerization and kinase activation by transautophosphorylation. Inhibited by chelerythrine chloride.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei106ATPPROSITE-ProRule annotation1 Publication1
Active sitei201Proton acceptorPROSITE-ProRule annotationBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi83 – 91ATPPROSITE-ProRule annotationBy similarity9
Zinc fingeri1012 – 1062Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST51

GO - Molecular functioni

  • ATP binding Source: UniProtKB
  • identical protein binding Source: IntAct
  • magnesium ion binding Source: UniProtKB
  • protein serine/threonine kinase activity Source: UniProtKB

GO - Biological processi

  • actin cytoskeleton reorganization Source: UniProtKB
  • actomyosin structure organization Source: UniProtKB
  • cell migration Source: UniProtKB
  • intracellular signal transduction Source: InterPro
  • protein phosphorylation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Magnesium, Metal-binding, Nucleotide-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:HS07105-MONOMER.
SignaLinkiQ5VT25.
SIGNORiQ5VT25.

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase MRCK alpha (EC:2.7.11.1)
Alternative name(s):
CDC42-binding protein kinase alpha
DMPK-like alpha
Myotonic dystrophy kinase-related CDC42-binding kinase alpha
Short name:
MRCK alpha
Short name:
Myotonic dystrophy protein kinase-like alpha
Gene namesi
Name:CDC42BPAImported
Synonyms:KIAA0451
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:1737. CDC42BPA.

Subcellular locationi

  • Cytoplasm By similarity

  • Note: Displays a dispersed punctate distribution and concentrates along the cell periphery, especially at the leading edge and cell-cell junction. This concentration is PH-domain dependent (By similarity).By similarity

GO - Cellular componenti

  • actomyosin Source: UniProtKB
  • cell-cell junction Source: UniProtKB
  • cell leading edge Source: UniProtKB
  • cytoplasm Source: UniProtKB-SubCell
  • extracellular exosome Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi106K → A: Loss of kinase activity. 1 Publication1
Mutagenesisi222S → L: Increase in autophosphorylation but not kinase activity. 1 Publication1
Mutagenesisi234S → A: Loss of autophosphorylation and kinase activity. 1 Publication1
Mutagenesisi240T → A: Loss of autophosphorylation and kinase activity. 1 Publication1
Mutagenesisi403T → A: Loss of autophosphorylation and kinase activity. 1 Publication1
Mutagenesisi1579H → A: Loss of CDC42 binding; when associated with A-1582. 1 Publication1
Mutagenesisi1582H → A: Loss of CDC42 binding; when associated with A-1579. 1 Publication1

Organism-specific databases

DisGeNETi8476.
OpenTargetsiENSG00000143776.
PharmGKBiPA26267.

Chemistry databases

ChEMBLiCHEMBL4516.
GuidetoPHARMACOLOGYi1507.

Polymorphism and mutation databases

BioMutaiCDC42BPA.
DMDMi74746874.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000863921 – 1732Serine/threonine-protein kinase MRCK alphaAdd BLAST1732

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei222Phosphoserine; by autocatalysis1 Publication1
Modified residuei234Phosphoserine; by autocatalysis1 Publication1
Modified residuei240Phosphothreonine; by autocatalysis1 Publication1
Modified residuei1127PhosphoserineBy similarity1
Modified residuei1545PhosphoserineCombined sources1
Modified residuei1611PhosphoserineCombined sources1
Modified residuei1613PhosphoserineCombined sources1
Modified residuei1629PhosphoserineCombined sources1
Modified residuei1651PhosphoserineCombined sources1
Modified residuei1664PhosphoserineCombined sources1
Modified residuei1669PhosphoserineCombined sources1
Modified residuei1693PhosphoserineCombined sources1
Modified residuei1719PhosphoserineCombined sources1
Modified residuei1721PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ5VT25.
MaxQBiQ5VT25.
PaxDbiQ5VT25.
PeptideAtlasiQ5VT25.
PRIDEiQ5VT25.

PTM databases

iPTMnetiQ5VT25.
PhosphoSitePlusiQ5VT25.

Expressioni

Tissue specificityi

Abundant in the heart, brain, skeletal muscle, kidney, and pancreas, with little or no expression in the lung and liver.1 Publication

Inductioni

Regulated by cellular iron levels.1 Publication

Gene expression databases

BgeeiENSG00000143776.
ExpressionAtlasiQ5VT25. baseline and differential.
GenevisibleiQ5VT25. HS.

Organism-specific databases

HPAiHPA061243.

Interactioni

Subunit structurei

Homodimer and homotetramer via the coiled coil regions. Interacts tightly with GTP-bound but not GDP-bound CDC42. Forms a tripartite complex with MYO18A and LURAP1 with the latter acting as an adapter connecting CDC42BPA and MYO18A. LURAP1 binding results in activation of CDC42BPA by abolition of its negative autoregulation.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
itself9EBI-689171,EBI-689171
CDC42P609535EBI-689171,EBI-81752

GO - Molecular functioni

  • identical protein binding Source: IntAct

Protein-protein interaction databases

BioGridi114051. 23 interactors.
IntActiQ5VT25. 22 interactors.
STRINGi9606.ENSP00000355731.

Chemistry databases

BindingDBiQ5VT25.

Structurei

3D structure databases

ProteinModelPortaliQ5VT25.
SMRiQ5VT25.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini77 – 343Protein kinasePROSITE-ProRule annotation1 PublicationAdd BLAST267
Domaini344 – 414AGC-kinase C-terminalAdd BLAST71
Domaini1082 – 1201PHPROSITE-ProRule annotationAdd BLAST120
Domaini1227 – 1499CNHPROSITE-ProRule annotationAdd BLAST273
Domaini1571 – 1584CRIBPROSITE-ProRule annotationAdd BLAST14

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili437 – 820Sequence analysisAdd BLAST384
Coiled coili880 – 943Sequence analysisAdd BLAST64

Sequence similaritiesi

Contains 1 AGC-kinase C-terminal domain.Curated
Contains 1 CNH domain.PROSITE-ProRule annotation
Contains 1 CRIB domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 phorbol-ester/DAG-type zinc finger.PROSITE-ProRule annotation
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri1012 – 1062Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST51

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiKOG0612. Eukaryota.
ENOG410XR1Q. LUCA.
GeneTreeiENSGT00760000118994.
HOVERGENiHBG055933.
InParanoidiQ5VT25.
KOiK16307.
OMAiTGFPPKR.
OrthoDBiEOG091G09EX.
PhylomeDBiQ5VT25.
TreeFamiTF313551.

Family and domain databases

CDDicd00029. C1. 1 hit.
Gene3Di2.30.29.30. 1 hit.
InterProiIPR000961. AGC-kinase_C.
IPR001180. CNH_dom.
IPR000095. CRIB_dom.
IPR031597. KELK.
IPR011009. Kinase-like_dom.
IPR014930. Myotonic_dystrophy_kinase_coil.
IPR002219. PE/DAG-bd.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR017892. Pkinase_C.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
IPR026611. Ser/Thr_kinase_MRCK_alpha.
[Graphical view]
PANTHERiPTHR22988:SF31. PTHR22988:SF31. 2 hits.
PfamiPF00130. C1_1. 1 hit.
PF00780. CNH. 1 hit.
PF08826. DMPK_coil. 1 hit.
PF15796. KELK. 1 hit.
PF00069. Pkinase. 1 hit.
PF00433. Pkinase_C. 1 hit.
[Graphical view]
ProDomiPD011252. Myotonic_dystrophy_kinase_coil. 1 hit.
[Graphical view] [Entries sharing at least one domain]
SMARTiSM00109. C1. 1 hit.
SM00036. CNH. 1 hit.
SM00285. PBD. 1 hit.
SM00233. PH. 1 hit.
SM00133. S_TK_X. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS51285. AGC_KINASE_CTER. 1 hit.
PS50219. CNH. 1 hit.
PS50108. CRIB. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist. They arise due to a two alternate splice sites, the first site involves splicing of exons 21-24 while the second site involves exons 36-40.
Isoform 1Curated (identifier: Q5VT25-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSGEVRLRQL EQFILDGPAQ TNGQCFSVET LLDILICLYD ECNNSPLRRE
60 70 80 90 100
KNILEYLEWA KPFTSKVKQM RLHREDFEIL KVIGRGAFGE VAVVKLKNAD
110 120 130 140 150
KVFAMKILNK WEMLKRAETA CFREERDVLV NGDNKWITTL HYAFQDDNNL
160 170 180 190 200
YLVMDYYVGG DLLTLLSKFE DRLPEDMARF YLAEMVIAID SVHQLHYVHR
210 220 230 240 250
DIKPDNILMD MNGHIRLADF GSCLKLMEDG TVQSSVAVGT PDYISPEILQ
260 270 280 290 300
AMEDGKGRYG PECDWWSLGV CMYEMLYGET PFYAESLVET YGKIMNHKER
310 320 330 340 350
FQFPAQVTDV SENAKDLIRR LICSREHRLG QNGIEDFKKH PFFSGIDWDN
360 370 380 390 400
IRNCEAPYIP EVSSPTDTSN FDVDDDCLKN SETMPPPTHT AFSGHHLPFV
410 420 430 440 450
GFTYTSSCVL SDRSCLRVTA GPTSLDLDVN VQRTLDNNLA TEAYERRIKR
460 470 480 490 500
LEQEKLELSR KLQESTQTVQ ALQYSTVDGP LTASKDLEIK NLKEEIEKLR
510 520 530 540 550
KQVTESSHLE QQLEEANAVR QELDDAFRQI KAYEKQIKTL QQEREDLNKE
560 570 580 590 600
LVQASERLKN QSKELKDAHC QRKLAMQEFM EINERLTELH TQKQKLARHV
610 620 630 640 650
RDKEEEVDLV MQKVESLRQE LRRTERAKKE LEVHTEALAA EASKDRKLRE
660 670 680 690 700
QSEHYSKQLE NELEGLKQKQ ISYSPGVCSI EHQQEITKLK TDLEKKSIFY
710 720 730 740 750
EEELSKREGI HANEIKNLKK ELHDSEGQQL ALNKEIMILK DKLEKTRRES
760 770 780 790 800
QSEREEFESE FKQQYEREKV LLTEENKKLT SELDKLTTLY ENLSIHNQQL
810 820 830 840 850
EEEVKDLADK KESVAHWEAQ ITEIIQWVSD EKDARGYLQA LASKMTEELE
860 870 880 890 900
ALRNSSLGTR ATDMPWKMRR FAKLDMSARL ELQSALDAEI RAKQAIQEEL
910 920 930 940 950
NKVKASNIIT ECKLKDSEKK NLELLSEIEQ LIKDTEELRS EKGIEHQDSQ
960 970 980 990 1000
HSFLAFLNTP TDALDQFERS PSCTPASKGR RTVDSTPLSV HTPTLRKKGC
1010 1020 1030 1040 1050
PGSTGFPPKR KTHQFFVKSF TTPTKCHQCT SLMVGLIRQG CSCEVCGFSC
1060 1070 1080 1090 1100
HITCVNKAPT TCPVPPEQTK GPLGIDPQKG IGTAYEGHVR IPKPAGVKKG
1110 1120 1130 1140 1150
WQRALAIVCD FKLFLYDIAE GKASQPSVVI SQVIDMRDEE FSVSSVLASD
1160 1170 1180 1190 1200
VIHASRKDIP CIFRVTASQL SASNNKCSIL MLADTENEKN KWVGVLSELH
1210 1220 1230 1240 1250
KILKKNKFRD RSVYVPKEAY DSTLPLIKTT QAAAIIDHER IALGNEEGLF
1260 1270 1280 1290 1300
VVHVTKDEII RVGDNKKIHQ IELIPNDQLV AVISGRNRHV RLFPMSALDG
1310 1320 1330 1340 1350
RETDFYKLSE TKGCQTVTSG KVRHGALTCL CVAMKRQVLC YELFQSKTRH
1360 1370 1380 1390 1400
RKFKEIQVPY NVQWMAIFSE QLCVGFQSGF LRYPLNGEGN PYSMLHSNDH
1410 1420 1430 1440 1450
TLSFIAHQPM DAICAVEISS KEYLLCFNSI GIYTDCQGRR SRQQELMWPA
1460 1470 1480 1490 1500
NPSSCCYNAP YLSVYSENAV DIFDVNSMEW IQTLPLKKVR PLNNEGSLNL
1510 1520 1530 1540 1550
LGLETIRLIY FKNKMAEGDE LVVPETSDNS RKQMVRNINN KRRYSFRVPE
1560 1570 1580 1590 1600
EERMQQRREM LRDPEMRNKL ISNPTNFNHI AHMGPGDGIQ ILKDLPMNPR
1610 1620 1630 1640 1650
PQESRTVFSG SVSIPSITKS RPEPGRSMSA SSGLSARSSA QNGSALKREF
1660 1670 1680 1690 1700
SGGSYSAKRQ PMPSPSEGSL SSGGMDQGSD APARDFDGED SDSPRHSTAS
1710 1720 1730
NSSNLSSPPS PASPRKTKSL SLESTDRGSW DP
Note: No experimental confirmation available.Curated
Length:1,732
Mass (Da):197,307
Last modified:December 7, 2004 - v1
Checksum:i48B10F81B5405A0A
GO
Isoform 2Curated (identifier: Q5VT25-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     969-969: R → TDPVENTYVWNPSVKFHIQSRST
     973-981: CTPASKGRR → TSSEAEPVK

Note: No experimental confirmation available.Curated
Show »
Length:1,754
Mass (Da):199,811
Checksum:iF1CC5CC1ED23B388
GO
Isoform 31 Publication (identifier: Q5VT25-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     550-630: Missing.
     969-981: Missing.

Show »
Length:1,638
Mass (Da):186,113
Checksum:i7783E19090B345F7
GO
Isoform 41 Publication (identifier: Q5VT25-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     969-1009: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:1,691
Mass (Da):193,031
Checksum:i28E904E222CFFEC5
GO
Isoform 51 Publication (identifier: Q5VT25-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     969-981: Missing.

Show »
Length:1,719
Mass (Da):195,922
Checksum:iDBB15FA879AAC871
GO
Isoform 6 (identifier: Q5VT25-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     969-981: Missing.
     1597-1597: M → MPGFPYPSPHHHSGLISSPINFEHIYHMTVNSAEKFLSPDSINPEYSPSLRSVPGTPSFMTLR

Show »
Length:1,781
Mass (Da):202,812
Checksum:i979DA0EF4F17F9DF
GO

Sequence cautioni

The sequence BAD92205 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti25C → Y in AAB37126 (PubMed:9092543).Curated1
Sequence conflicti809D → N in CAI46252 (PubMed:17974005).Curated1
Sequence conflicti1521L → V (PubMed:9418861).Curated1
Sequence conflicti1688G → K in BAA32296 (PubMed:9455484).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04083050E → K in a lung neuroendocrine carcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_040831231T → M.1 PublicationCorresponds to variant rs34614709dbSNPEnsembl.1
Natural variantiVAR_040832537I → T.1 PublicationCorresponds to variant rs56364976dbSNPEnsembl.1
Natural variantiVAR_045583780T → M.1 PublicationCorresponds to variant rs56119119dbSNPEnsembl.1
Natural variantiVAR_045584790Y → C.1 PublicationCorresponds to variant rs34943764dbSNPEnsembl.1
Natural variantiVAR_0455851148A → T.1 PublicationCorresponds to variant rs56219089dbSNPEnsembl.1
Natural variantiVAR_0455861211R → H.1 PublicationCorresponds to variant rs961490dbSNPEnsembl.1
Natural variantiVAR_0455871317V → I.2 PublicationsCorresponds to variant rs1929860dbSNPEnsembl.1
Natural variantiVAR_0408331418I → K.1 Publication1
Natural variantiVAR_0455881469A → V.1 PublicationCorresponds to variant rs55687355dbSNPEnsembl.1
Natural variantiVAR_0455891618T → A.1 PublicationCorresponds to variant rs2297417dbSNPEnsembl.1
Natural variantiVAR_0455901699A → V.Corresponds to variant rs2802269dbSNPEnsembl.1
Natural variantiVAR_0571041712A → V.3 PublicationsCorresponds to variant rs2802269dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_051859550 – 630Missing in isoform 3. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_051862969 – 1009Missing in isoform 4. 2 PublicationsAdd BLAST41
Alternative sequenceiVSP_051860969 – 981Missing in isoform 3, isoform 5 and isoform 6. 2 PublicationsAdd BLAST13
Alternative sequenceiVSP_051861969R → TDPVENTYVWNPSVKFHIQS RST in isoform 2. 1 Publication1
Alternative sequenceiVSP_051863973 – 981CTPASKGRR → TSSEAEPVK in isoform 2. 1 Publication9
Alternative sequenceiVSP_0352861597M → MPGFPYPSPHHHSGLISSPI NFEHIYHMTVNSAEKFLSPD SINPEYSPSLRSVPGTPSFM TLR in isoform 6. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ518975 mRNA. Translation: CAD57745.1.
AJ518976 mRNA. Translation: CAD57746.1.
AB208968 mRNA. Translation: BAD92205.1. Different initiation.
CR933723 mRNA. Translation: CAI46252.1.
AL353689 Genomic DNA. Translation: CAI19113.1.
AL451047, AL353689, AL627308 Genomic DNA. Translation: CAH71184.1.
AL451047, AL627308, AL353689 Genomic DNA. Translation: CAH71185.1.
AL627308, AL353689, AL451047 Genomic DNA. Translation: CAH71336.1.
AL627308, AL353689, AL451047 Genomic DNA. Translation: CAH71337.1.
AL353689, AL451047, AL627308 Genomic DNA. Translation: CAI19108.1.
AL451047, AL353689, AL627308 Genomic DNA. Translation: CAH71183.1.
AL627308, AL353689, AL451047 Genomic DNA. Translation: CAH71338.1.
AL353689, AL627308, AL451047 Genomic DNA. Translation: CAI19109.1.
AL353689, AL451047, AL627308 Genomic DNA. Translation: CAI19110.1.
AB007920 mRNA. Translation: BAA32296.2.
U59305 mRNA. Translation: AAB37126.1.
CCDSiCCDS1558.1. [Q5VT25-5]
CCDS1559.1. [Q5VT25-3]
RefSeqiNP_003598.2. NM_003607.3. [Q5VT25-5]
NP_055641.3. NM_014826.4. [Q5VT25-3]
XP_005273378.1. XM_005273321.3. [Q5VT25-6]
XP_005273379.1. XM_005273322.3. [Q5VT25-2]
XP_005273381.1. XM_005273324.3. [Q5VT25-1]
UniGeneiHs.35433.

Genome annotation databases

EnsembliENST00000334218; ENSP00000335341; ENSG00000143776. [Q5VT25-1]
ENST00000366767; ENSP00000355729; ENSG00000143776. [Q5VT25-3]
ENST00000366769; ENSP00000355731; ENSG00000143776. [Q5VT25-5]
GeneIDi8476.
KEGGihsa:8476.
UCSCiuc001hqr.4. human. [Q5VT25-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ518975 mRNA. Translation: CAD57745.1.
AJ518976 mRNA. Translation: CAD57746.1.
AB208968 mRNA. Translation: BAD92205.1. Different initiation.
CR933723 mRNA. Translation: CAI46252.1.
AL353689 Genomic DNA. Translation: CAI19113.1.
AL451047, AL353689, AL627308 Genomic DNA. Translation: CAH71184.1.
AL451047, AL627308, AL353689 Genomic DNA. Translation: CAH71185.1.
AL627308, AL353689, AL451047 Genomic DNA. Translation: CAH71336.1.
AL627308, AL353689, AL451047 Genomic DNA. Translation: CAH71337.1.
AL353689, AL451047, AL627308 Genomic DNA. Translation: CAI19108.1.
AL451047, AL353689, AL627308 Genomic DNA. Translation: CAH71183.1.
AL627308, AL353689, AL451047 Genomic DNA. Translation: CAH71338.1.
AL353689, AL627308, AL451047 Genomic DNA. Translation: CAI19109.1.
AL353689, AL451047, AL627308 Genomic DNA. Translation: CAI19110.1.
AB007920 mRNA. Translation: BAA32296.2.
U59305 mRNA. Translation: AAB37126.1.
CCDSiCCDS1558.1. [Q5VT25-5]
CCDS1559.1. [Q5VT25-3]
RefSeqiNP_003598.2. NM_003607.3. [Q5VT25-5]
NP_055641.3. NM_014826.4. [Q5VT25-3]
XP_005273378.1. XM_005273321.3. [Q5VT25-6]
XP_005273379.1. XM_005273322.3. [Q5VT25-2]
XP_005273381.1. XM_005273324.3. [Q5VT25-1]
UniGeneiHs.35433.

3D structure databases

ProteinModelPortaliQ5VT25.
SMRiQ5VT25.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114051. 23 interactors.
IntActiQ5VT25. 22 interactors.
STRINGi9606.ENSP00000355731.

Chemistry databases

BindingDBiQ5VT25.
ChEMBLiCHEMBL4516.
GuidetoPHARMACOLOGYi1507.

PTM databases

iPTMnetiQ5VT25.
PhosphoSitePlusiQ5VT25.

Polymorphism and mutation databases

BioMutaiCDC42BPA.
DMDMi74746874.

Proteomic databases

EPDiQ5VT25.
MaxQBiQ5VT25.
PaxDbiQ5VT25.
PeptideAtlasiQ5VT25.
PRIDEiQ5VT25.

Protocols and materials databases

DNASUi8476.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000334218; ENSP00000335341; ENSG00000143776. [Q5VT25-1]
ENST00000366767; ENSP00000355729; ENSG00000143776. [Q5VT25-3]
ENST00000366769; ENSP00000355731; ENSG00000143776. [Q5VT25-5]
GeneIDi8476.
KEGGihsa:8476.
UCSCiuc001hqr.4. human. [Q5VT25-1]

Organism-specific databases

CTDi8476.
DisGeNETi8476.
GeneCardsiCDC42BPA.
H-InvDBHIX0001650.
HGNCiHGNC:1737. CDC42BPA.
HPAiHPA061243.
MIMi603412. gene.
neXtProtiNX_Q5VT25.
OpenTargetsiENSG00000143776.
PharmGKBiPA26267.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0612. Eukaryota.
ENOG410XR1Q. LUCA.
GeneTreeiENSGT00760000118994.
HOVERGENiHBG055933.
InParanoidiQ5VT25.
KOiK16307.
OMAiTGFPPKR.
OrthoDBiEOG091G09EX.
PhylomeDBiQ5VT25.
TreeFamiTF313551.

Enzyme and pathway databases

BioCyciZFISH:HS07105-MONOMER.
SignaLinkiQ5VT25.
SIGNORiQ5VT25.

Miscellaneous databases

ChiTaRSiCDC42BPA. human.
GeneWikiiCDC42BPA.
GenomeRNAii8476.
PROiQ5VT25.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000143776.
ExpressionAtlasiQ5VT25. baseline and differential.
GenevisibleiQ5VT25. HS.

Family and domain databases

CDDicd00029. C1. 1 hit.
Gene3Di2.30.29.30. 1 hit.
InterProiIPR000961. AGC-kinase_C.
IPR001180. CNH_dom.
IPR000095. CRIB_dom.
IPR031597. KELK.
IPR011009. Kinase-like_dom.
IPR014930. Myotonic_dystrophy_kinase_coil.
IPR002219. PE/DAG-bd.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR017892. Pkinase_C.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
IPR026611. Ser/Thr_kinase_MRCK_alpha.
[Graphical view]
PANTHERiPTHR22988:SF31. PTHR22988:SF31. 2 hits.
PfamiPF00130. C1_1. 1 hit.
PF00780. CNH. 1 hit.
PF08826. DMPK_coil. 1 hit.
PF15796. KELK. 1 hit.
PF00069. Pkinase. 1 hit.
PF00433. Pkinase_C. 1 hit.
[Graphical view]
ProDomiPD011252. Myotonic_dystrophy_kinase_coil. 1 hit.
[Graphical view] [Entries sharing at least one domain]
SMARTiSM00109. C1. 1 hit.
SM00036. CNH. 1 hit.
SM00285. PBD. 1 hit.
SM00233. PH. 1 hit.
SM00133. S_TK_X. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS51285. AGC_KINASE_CTER. 1 hit.
PS50219. CNH. 1 hit.
PS50108. CRIB. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMRCKA_HUMAN
AccessioniPrimary (citable) accession number: Q5VT25
Secondary accession number(s): O75039
, Q59GZ1, Q5H9N9, Q5T797, Q5VT26, Q5VT27, Q86XX2, Q86XX3, Q99646
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 8, 2005
Last sequence update: December 7, 2004
Last modified: November 30, 2016
This is version 130 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.