Q5VT25 (MRCKA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 92.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Serine/threonine-protein kinase MRCK alpha EC=2.7.11.1 Alternative name(s): CDC42-binding protein kinase alpha DMPK-like alpha Myotonic dystrophy kinase-related CDC42-binding kinase alpha Short name=MRCK alpha Short name=Myotonic dystrophy protein kinase-like alpha | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1732 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine/threonine-protein kinase which is an important downstream effector of CDC42 and plays a role in the regulation of cytoskeleton reorganization and cell migration. Regulates actin cytoskeletal reorganization via phosphorylation of PPP1R12C and MYL9/MLC2. In concert with MYO18A and LURAP1, is involved in modulating lamellar actomyosin retrograde flow that is crucial to cell protrusion and migration. Phosphorylates: PPP1R12A, LIMK1 and LIMK2. May play a role in TFRC-mediated iron uptake. Ref.1 Ref.5 Ref.8 Ref.9 Ref.10 Ref.13 Ref.15 Ref.17 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. Ref.5 |
| Cofactor | Magnesium. Ref.5 |
| Enzyme regulation | Maintained in an inactive, closed conformation by an interaction between the kinase domain and the negative autoregulatory C-terminal coiled-coil region. Agonist binding to the phorbol ester binding site disrupts this, releasing the kinase domain to allow N-terminus-mediated dimerization and kinase activation by transautophosphorylation. Inhibited by chelerythrine chloride. Ref.11 Ref.17 |
| Subunit structure | Homodimer and homotetramer via the coiled coil regions. Interacts tightly with GTP-bound but not GDP-bound CDC42. Forms a tripartite complex with MYO18A and LURAP1 with the latter acting as an adapter connecting CDC42BPA and MYO18A. LURAP1 binding results in activation of CDC42BPA by abolition of its negative autoregulation. Ref.8 Ref.11 Ref.13 |
| Subcellular location | Cytoplasm By similarity. Note: Displays a dispersed punctate distribution and concentrates along the cell periphery, especially at the leading edge and cell-cell junction. This concentration is PH-domain dependent By similarity. |
| Tissue specificity | Abundant in the heart, brain, skeletal muscle, kidney, and pancreas, with little or no expression in the lung and liver. Ref.5 |
| Induction | |
| Sequence similarities | Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. DMPK subfamily. Contains 1 AGC-kinase C-terminal domain. Contains 1 CNH domain. Contains 1 CRIB domain. Contains 1 PH domain. Contains 1 phorbol-ester/DAG-type zinc finger. Contains 1 protein kinase domain. |
| Sequence caution | The sequence BAD92205.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 9 | EBI-689171,EBI-689171 | ||
| CDC42 | P60953 | 5 | EBI-689171,EBI-81752 |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. They arise due to a two alternate splice sites, the first site involves splicing of exons 21-24 while the second site involves exons 36-40. | ||||||
| Isoform 1 (identifier: Q5VT25-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: Q5VT25-2) The sequence of this isoform differs from the canonical sequence as follows: 969-969: R → TDPVENTYVWNPSVKFHIQSRST 973-981: CTPASKGRR → TSSEAEPVK | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 Ref.1 (identifier: Q5VT25-3) The sequence of this isoform differs from the canonical sequence as follows: 550-630: Missing. 969-981: Missing. | ||||||
| Isoform 4 Ref.4 (identifier: Q5VT25-4) The sequence of this isoform differs from the canonical sequence as follows: 969-1009: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 Ref.1 (identifier: Q5VT25-5) The sequence of this isoform differs from the canonical sequence as follows: 969-981: Missing. | ||||||
| Isoform 6 (identifier: Q5VT25-6) The sequence of this isoform differs from the canonical sequence as follows: 969-981: Missing. 1597-1597: M → MPGFPYPSPHHHSGLISSPINFEHIYHMTVNSAEKFLSPDSINPEYSPSLRSVPGTPSFMTLR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1732 | 1732 | Serine/threonine-protein kinase MRCK alpha | PRO_0000086392 | |||||
Regions | |||||||||
| Domain | 77 – 343 | 267 | Protein kinase Ref.5 | ||||||
| Domain | 344 – 414 | 71 | AGC-kinase C-terminal | ||||||
| Domain | 1082 – 1201 | 120 | PH | ||||||
| Domain | 1227 – 1499 | 273 | CNH | ||||||
| Domain | 1571 – 1584 | 14 | CRIB | ||||||
| Nucleotide binding | 83 – 91 | 9 | ATP By similarity UniProtKB P54265 | ||||||
| Zinc finger | 1012 – 1062 | 51 | Phorbol-ester/DAG-type | ||||||
| Coiled coil | 437 – 820 | 384 | Potential | ||||||
| Coiled coil | 880 – 943 | 64 | Potential | ||||||
Sites | |||||||||
| Active site | 201 | 1 | Proton acceptor By similarity UniProtKB P54265 | ||||||
| Binding site | 106 | 1 | ATP Ref.11 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 222 | 1 | Phosphoserine; by autocatalysis Ref.11 | ||||||
| Modified residue | 234 | 1 | Phosphoserine; by autocatalysis Ref.11 | ||||||
| Modified residue | 240 | 1 | Phosphothreonine; by autocatalysis Ref.11 | ||||||
| Modified residue | 1545 | 1 | Phosphoserine Ref.14 | ||||||
| Modified residue | 1651 | 1 | Phosphoserine Ref.18 | ||||||
| Modified residue | 1719 | 1 | Phosphoserine Ref.14 | ||||||
| Modified residue | 1721 | 1 | Phosphoserine Ref.14 | ||||||
Natural variations | |||||||||
| Alternative sequence | 550 – 630 | 81 | Missing in isoform 3. Ref.1 | VSP_051859 | |||||
| Alternative sequence | 969 – 1009 | 41 | Missing in isoform 4. Ref.4 | VSP_051862 | |||||
| Alternative sequence | 969 – 981 | 13 | Missing in isoform 3, isoform 5 and isoform 6. Ref.1 | VSP_051860 | |||||
| Alternative sequence | 969 | 1 | R → TDPVENTYVWNPSVKFHIQS RST in isoform 2. | VSP_051861 | |||||
| Alternative sequence | 973 – 981 | 9 | CTPASKGRR → TSSEAEPVK in isoform 2. | VSP_051863 | |||||
| Alternative sequence | 1597 | 1 | M → MPGFPYPSPHHHSGLISSPI NFEHIYHMTVNSAEKFLSPD SINPEYSPSLRSVPGTPSFM TLR in isoform 6. | VSP_035286 | |||||
| Natural variant | 50 | 1 | E → K in a lung neuroendocrine carcinoma sample; somatic mutation. Ref.19 | VAR_040830 | |||||
| Natural variant | 231 | 1 | T → M. Ref.19 Corresponds to variant rs34614709 [ dbSNP | Ensembl ]. | VAR_040831 | |||||
| Natural variant | 537 | 1 | I → T. Ref.19 Corresponds to variant rs56364976 [ dbSNP | Ensembl ]. | VAR_040832 | |||||
| Natural variant | 780 | 1 | T → M. Ref.19 Corresponds to variant rs56119119 [ dbSNP | Ensembl ]. | VAR_045583 | |||||
| Natural variant | 790 | 1 | Y → C. Ref.19 Corresponds to variant rs34943764 [ dbSNP | Ensembl ]. | VAR_045584 | |||||
| Natural variant | 1148 | 1 | A → T. Ref.19 | VAR_045585 | |||||
| Natural variant | 1211 | 1 | R → H. Ref.19 | VAR_045586 | |||||
| Natural variant | 1317 | 1 | V → I. Ref.3 Ref.19 | VAR_045587 | |||||
| Natural variant | 1418 | 1 | I → K. Ref.19 | VAR_040833 | |||||
| Natural variant | 1469 | 1 | A → V. Ref.19 Corresponds to variant rs55687355 [ dbSNP | Ensembl ]. | VAR_045588 | |||||
| Natural variant | 1618 | 1 | T → A. Ref.19 | VAR_045589 | |||||
| Natural variant | 1699 | 1 | A → V. Corresponds to variant rs2802269 [ dbSNP | Ensembl ]. | VAR_045590 | |||||
| Natural variant | 1712 | 1 | A → V. Ref.2 Ref.3 Ref.6 Corresponds to variant rs2802269 [ dbSNP | Ensembl ]. | VAR_057104 | |||||
Experimental info | |||||||||
| Mutagenesis | 106 | 1 | K → A: Loss of kinase activity. Ref.11 | ||||||
| Mutagenesis | 222 | 1 | S → L: Increase in autophosphorylation but not kinase activity. Ref.11 | ||||||
| Mutagenesis | 234 | 1 | S → A: Loss of autophosphorylation and kinase activity. Ref.11 | ||||||
| Mutagenesis | 240 | 1 | T → A: Loss of autophosphorylation and kinase activity. Ref.11 | ||||||
| Mutagenesis | 403 | 1 | T → A: Loss of autophosphorylation and kinase activity. Ref.11 | ||||||
| Mutagenesis | 1579 | 1 | H → A: Loss of CDC42 binding; when associated with A-1582. Ref.8 | ||||||
| Mutagenesis | 1582 | 1 | H → A: Loss of CDC42 binding; when associated with A-1579. Ref.8 | ||||||
| Sequence conflict | 25 | 1 | C → Y in AAB37126. Ref.5 | ||||||
| Sequence conflict | 809 | 1 | D → N in CAI46252. Ref.3 | ||||||
| Sequence conflict | 1521 | 1 | L → V Ref.8 | ||||||
| Sequence conflict | 1688 | 1 | G → K in BAA32296. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cdc42-MRCK and Rho-ROCK signalling cooperate in myosin phosphorylation and cell invasion." Wilkinson S., Paterson H.F., Marshall C.J. Nat. Cell Biol. 7:255-261(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 5), FUNCTION. Tissue: Colon. |
| [2] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT VAL-1712. Tissue: Brain. |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS ILE-1317 AND VAL-1712. Tissue: Testis. |
| [4] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "Cloning and chromosomal location of a novel member of the myotonic dystrophy family of protein kinases." Zhao Y., Loyer P., Li H., Valentine V., Kidd V., Kraft A.S. J. Biol. Chem. 272:10013-10020(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-496, FUNCTION, TISSUE SPECIFICITY. Tissue: Mammary gland. |
| [6] | "Characterization of cDNA clones in size-fractionated cDNA libraries from human brain." Seki N., Ohira M., Nagase T., Ishikawa K., Miyajima N., Nakajima D., Nomura N., Ohara O. DNA Res. 4:345-349(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 799-1732 (ISOFORM 6), VARIANT VAL-1712. Tissue: Brain. |
| [7] | Ohara O. Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [8] | "Myotonic dystrophy kinase-related Cdc42-binding kinase acts as a Cdc42 effector in promoting cytoskeletal reorganization." Leung T., Chen X.-Q., Tan I., Manser E., Lim L. Mol. Cell. Biol. 18:130-140(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1521-1644, FUNCTION, INTERACTION WITH CDC42, MUTAGENESIS OF HIS-1579 AND HIS-1582. Tissue: Brain. |
| [9] | "Phosphorylation of a novel myosin binding subunit of protein phosphatase 1 reveals a conserved mechanism in the regulation of actin cytoskeleton." Tan I., Ng C.H., Lim L., Leung T. J. Biol. Chem. 276:21209-21216(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF PPP1R12C. |
| [10] | "Activation of LIM kinases by myotonic dystrophy kinase-related Cdc42-binding kinase alpha." Sumi T., Matsumoto K., Shibuya A., Nakamura T. J. Biol. Chem. 276:23092-23096(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF LIMK1 AND LIMK2. |
| [11] | "Intermolecular and intramolecular interactions regulate catalytic activity of myotonic dystrophy kinase-related Cdc42-binding kinase alpha." Tan I., Seow K.T., Lim L., Leung T. Mol. Cell. Biol. 21:2767-2778(2001) [PubMed] [Europe PMC] [Abstract] Cited for: ENZYME REGULATION, OLIGOMERIZATION, PHOSPHORYLATION AT SER-222; SER-234 AND THR-240, MUTAGENESIS OF LYS-106; SER-222; SER-234; THR-240 AND THR-403. |
| [12] | "Genomic organization of human myotonic dystrophy kinase-related Cdc42-binding kinase alpha reveals multiple alternative splicing and functional diversity." Tan I., Cheong A., Lim L., Leung T. Gene 304:107-115(2003) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING. |
| [13] | "A tripartite complex containing MRCK modulates lamellar actomyosin retrograde flow." Tan I., Yong J., Dong J.M., Lim L., Leung T. Cell 135:123-136(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH LURAP1 AND MYO18A. |
| [14] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1545; SER-1719 AND SER-1721, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "Human MRCKalpha is regulated by cellular iron levels and interferes with transferrin iron uptake." Cmejla R., Ptackova P., Petrak J., Savvulidi F., Cerny J., Sebesta O., Vyoral D. Biochem. Biophys. Res. Commun. 395:163-167(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INDUCTION. |
| [16] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [17] | "Chelerythrine perturbs lamellar actomyosin filaments by selective inhibition of myotonic dystrophy kinase-related Cdc42-binding kinase." Tan I., Lai J., Yong J., Li S.F., Leung T. FEBS Lett. 585:1260-1268(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF PPP1R12A AND MYL9/MLC2, ENZYME REGULATION. |
| [18] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1651, MASS SPECTROMETRY. |
| [19] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] LYS-50; MET-231; THR-537; MET-780; CYS-790; THR-1148; HIS-1211; ILE-1317; LYS-1418; VAL-1469 AND ALA-1618. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ518975 mRNA. Translation: CAD57745.1. AJ518976 mRNA. Translation: CAD57746.1. AB208968 mRNA. Translation: BAD92205.1. Different initiation. CR933723 mRNA. Translation: CAI46252.1. AL353689 Genomic DNA. Translation: CAI19113.1. AL451047, AL353689, AL627308 Genomic DNA. Translation: CAH71184.1. AL451047, AL627308, AL353689 Genomic DNA. Translation: CAH71185.1. AL627308, AL353689, AL451047 Genomic DNA. Translation: CAH71336.1. AL627308, AL353689, AL451047 Genomic DNA. Translation: CAH71337.1. AL353689, AL451047, AL627308 Genomic DNA. Translation: CAI19108.1. AL451047, AL353689, AL627308 Genomic DNA. Translation: CAH71183.1. AL627308, AL353689, AL451047 Genomic DNA. Translation: CAH71338.1. AL353689, AL627308, AL451047 Genomic DNA. Translation: CAI19109.1. AL353689, AL451047, AL627308 Genomic DNA. Translation: CAI19110.1. AB007920 mRNA. Translation: BAA32296.2. U59305 mRNA. Translation: AAB37126.1. |
| IPI | IPI00550263. IPI00640468. IPI00640957. IPI00642165. IPI00654830. IPI00903296. |
| RefSeq | NP_003598.2. NM_003607.3. NP_055641.3. NM_014826.4. |
| UniGene | Hs.35433. |
3D structure databases | |
| ProteinModelPortal | Q5VT25. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q5VT25. 7 interactions. |
PTM databases | |
| PhosphoSite | Q5VT25. |
Polymorphism databases | |
| DMDM | 74746874. |
Proteomic databases | |
| PaxDb | Q5VT25. |
| PRIDE | Q5VT25. |
Protocols and materials databases | |
| DNASU | 8476. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000334218; ENSP00000335341; ENSG00000143776. ENST00000366764; ENSP00000355726; ENSG00000143776. ENST00000366765; ENSP00000355727; ENSG00000143776. ENST00000366766; ENSP00000355728; ENSG00000143776. ENST00000366767; ENSP00000355729; ENSG00000143776. ENST00000366769; ENSP00000355731; ENSG00000143776. |
| GeneID | 8476. |
| KEGG | hsa:8476. |
| UCSC | uc001hqq.3. human. uc001hqr.3. human. uc001hqs.3. human. uc009xes.3. human. |
Organism-specific databases | |
| CTD | 8476. |
| GeneCards | GC01M227177. |
| H-InvDB | HIX0001650. |
| HGNC | HGNC:1737. CDC42BPA. |
| MIM | 603412. gene. |
| neXtProt | NX_Q5VT25. |
| PharmGKB | PA26267. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0515. |
| HOVERGEN | HBG055933. |
| KO | K16307. |
| OMA | LRKKGCP. |
Gene expression databases | |
| ArrayExpress | Q5VT25. |
| Bgee | Q5VT25. |
| Genevestigator | Q5VT25. |
| GermOnline | ENSG00000143776. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000961. AGC-kinase_C. IPR001180. Citron. IPR011009. Kinase-like_dom. IPR014930. Myotonic_dystrophy_kinase_coil. IPR000095. PAK_box_Rho-bd. IPR017892. Pkinase_C. IPR001849. Pleckstrin_homology. IPR002219. Prot_Kinase_C-like_PE/DAG-bd. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. IPR026611. Ser/Thr_kinase_MRCK. [Graphical view] |
| PANTHER | PTHR22988:SF2. PTHR22988:SF2. 1 hit. |
| Pfam | PF00130. C1_1. 1 hit. PF00780. CNH. 1 hit. PF08826. DMPK_coil. 1 hit. PF00069. Pkinase. 1 hit. PF00433. Pkinase_C. 1 hit. [Graphical view] |
| ProDom | PD011252. Myotonic_dystrophy_kinase_coil. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00109. C1. 1 hit. SM00036. CNH. 1 hit. SM00285. PBD. 1 hit. SM00233. PH. 1 hit. SM00133. S_TK_X. 1 hit. SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS51285. AGC_KINASE_CTER. 1 hit. PS50219. CNH. 1 hit. PS50108. CRIB. 1 hit. PS50003. PH_DOMAIN. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. PS00479. ZF_DAG_PE_1. 1 hit. PS50081. ZF_DAG_PE_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q5VT25. |
| ChEMBL | CHEMBL4516. |
| ChiTaRS | CDC42BPA. human. |
| GenomeRNAi | 8476. |
| NextBio | 31715. |
| SOURCE | Search... |
Entry information
| Entry name | MRCKA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5VT25 Secondary accession number(s): O75039 Q99646 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
