Q5VQL1 (RH14_ORYSJ) Reviewed, UniProtKB/Swiss-Prot
Last modified
September 21, 2011.
Version 49.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: DEAD-box ATP-dependent RNA helicase 14 EC=3.6.4.13 | ||||
| Gene names |
| ||||
| Organism | Oryza sativa subsp. japonica (Rice) | ||||
| Taxonomic identifier | 39947 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › Liliopsida › Poales › Poaceae › BEP clade › Ehrhartoideae › Oryzeae › Oryza |
Protein attributes
| Sequence length | 708 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | ATP-dependent RNA helicase involved nonsense-mediated mRNA decay and ribosome biogenesis through rRNA processing By similarity. |
| Catalytic activity | ATP + H2O = ADP + phosphate. |
| Subcellular location | Nucleus By similarity. |
| Domain | The Q motif is unique to and characteristic of the DEAD box family of RNA helicases and controls ATP binding and hydrolysis. |
| Sequence similarities | Belongs to the DEAD box helicase family. DDX5/DBP2 subfamily. Contains 1 helicase ATP-binding domain. Contains 1 helicase C-terminal domain. Contains 1 WW domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Nonsense-mediated mRNA decay Ribosome biogenesis rRNA processing |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding Nucleotide-binding RNA-binding |
| Molecular function | Helicase Hydrolase |
| Gene Ontology (GO) | |
| Biological process | nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Inferred from electronic annotation. Source: UniProtKB-KW rRNA processingInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW ATP-dependent helicase activityInferred from electronic annotation. Source: InterPro RNA bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5VQL1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Derived from EST data. No experimental confirmation available. | ||||||
| Isoform 2 (identifier: Q5VQL1-2) The sequence of this isoform differs from the canonical sequence as follows: 195-195: V → VSAHNLHDYLMHFLVSFSKEIRRSLCVHTTYVITTLDVHLSRLFKSTIYVKV | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q5VQL1-3) The sequence of this isoform differs from the canonical sequence as follows: 650-650: Missing. | ||||||
| Note: Derived from EST data. May be due to competing acceptor splice site. No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 708 | 708 | DEAD-box ATP-dependent RNA helicase 14 | PRO_0000282454 | |||||
Regions | |||||||||
| Domain | 21 – 55 | 35 | WW | ||||||
| Domain | 211 – 385 | 175 | Helicase ATP-binding | ||||||
| Domain | 414 – 558 | 145 | Helicase C-terminal | ||||||
| Nucleotide binding | 224 – 231 | 8 | ATP By similarity | ||||||
| Motif | 180 – 208 | 29 | Q motif | ||||||
| Motif | 333 – 336 | 4 | DEAD box | ||||||
| Compositional bias | 2 – 11 | 10 | Poly-Ala | ||||||
| Compositional bias | 572 – 675 | 104 | Ser-rich | ||||||
Natural variations | |||||||||
| Alternative sequence | 195 | 1 | V → VSAHNLHDYLMHFLVSFSKE IRRSLCVHTTYVITTLDVHL SRLFKSTIYVKV in isoform 2. | VSP_024155 | |||||
| Alternative sequence | 650 | 1 | Missing in isoform 3. | VSP_024156 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AP003282 Genomic DNA. Translation: BAD68263.1. AP003282 Genomic DNA. Translation: BAD68264.1. AP008207 Genomic DNA. Translation: BAF04065.1. AK100326 mRNA. No translation available. |
| RefSeq | NP_001042151.1. NM_001048686.1. |
| UniGene | Os.7205. |
3D structure databases | |
| HSSP | HSSP built from PDB template 2DB3 based on UniProtKB P09052. |
| ProteinModelPortal | Q5VQL1. |
| ModBase | Search... |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblPlants | LOC_Os01g07740.3; LOC_Os01g07740.3; LOC_Os01g07740. |
| GeneID | 4327645. |
| KEGG | osa:4327645. |
Organism-specific databases | |
| Gramene | Q5VQL1. |
Phylogenomic databases | |
| GeneTree | EPGT00070000030127. |
| HOGENOM | HBG737336. |
| OMA | QEPGSKI. |
| PhylomeDB | Q5VQL1. |
| ProtClustDB | CLSN2691107. |
Family and domain databases | |
| InterPro | IPR014001. DEAD-like_helicase. IPR011545. DNA/RNA_helicase_DEAD/DEAH_N. IPR001650. Helicase_C. IPR000629. RNA-helicase_DEAD-box_CS. IPR014014. RNA_helicase_DEAD_Q_motif. IPR001202. WW_Rsp5_WWP. [Graphical view] |
| Gene3D | G3DSA:2.20.70.10. G3DSA:2.20.70.10. 1 hit. |
| Pfam | PF00270. DEAD. 1 hit. PF00271. Helicase_C. 1 hit. PF00397. WW. 1 hit. [Graphical view] |
| SMART | SM00487. DEXDc. 1 hit. SM00490. HELICc. 1 hit. SM00456. WW. 1 hit. [Graphical view] |
| SUPFAM | SSF51045. WW_Rsp5_WWP. 1 hit. |
| PROSITE | PS00039. DEAD_ATP_HELICASE. 1 hit. PS51192. HELICASE_ATP_BIND_1. 1 hit. PS51194. HELICASE_CTER. 1 hit. PS51195. Q_MOTIF. 1 hit. PS01159. WW_DOMAIN_1. False negative. PS50020. WW_DOMAIN_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | RH14_ORYSJ | ||||||||
| Accession | Primary (citable) accession number: Q5VQL1 Secondary accession number(s): Q5VQL2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Plant Protein Annotation Program | ||||||||
Relevant documents
| Oryza sativa (rice) Index of Oryza sativa entries and their corresponding gene designations |
| SIMILARITY comments Index of protein domains and families |

Clusters with