Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mesoderm induction early response protein 1

Gene

Mier1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Transcriptional repressor regulating the expression of a number of genes including SP1 target genes. Probably functions through recruitment of HDAC1 a histone deacetylase involved in chromatin silencing.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Mesoderm induction early response protein 1
Short name:
Early response 1
Short name:
Er1
Short name:
Mi-er1
Gene namesi
Name:Mier1
Synonyms:Kiaa1610
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:1918398. Mier1.

Subcellular locationi

  • Nucleus PROSITE-ProRule annotation

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 511511Mesoderm induction early response protein 1PRO_0000197142Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei10 – 101PhosphoserineBy similarity
Modified residuei140 – 1401PhosphoserineBy similarity
Modified residuei154 – 1541PhosphotyrosineBy similarity
Modified residuei159 – 1591PhosphoserineCombined sources
Modified residuei165 – 1651PhosphoserineCombined sources
Modified residuei366 – 3661PhosphoserineBy similarity
Modified residuei368 – 3681PhosphoserineBy similarity
Modified residuei376 – 3761PhosphoserineCombined sources
Cross-linki419 – 419Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei482 – 4821PhosphoserineCombined sources
Modified residuei487 – 4871PhosphoserineCombined sources
Modified residuei490 – 4901PhosphoserineBy similarity

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ5UAK0.
MaxQBiQ5UAK0.
PaxDbiQ5UAK0.
PeptideAtlasiQ5UAK0.
PRIDEiQ5UAK0.

PTM databases

iPTMnetiQ5UAK0.
PhosphoSiteiQ5UAK0.

Expressioni

Tissue specificityi

Ubiquitously expressed. Isoform 1 is only expressed in testis.1 Publication

Gene expression databases

BgeeiQ5UAK0.
ExpressionAtlasiQ5UAK0. baseline and differential.
GenevisibleiQ5UAK0. MM.

Interactioni

Subunit structurei

Interacts with HDAC1. Part of a complex containing at least CDYL, MIER1, MIER2, HDAC1 and HDAC2.By similarity

Protein-protein interaction databases

IntActiQ5UAK0. 1 interaction.
MINTiMINT-4126928.
STRINGi10090.ENSMUSP00000030247.

Structurei

3D structure databases

ProteinModelPortaliQ5UAK0.
SMRiQ5UAK0. Positions 287-332.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini179 – 27799ELM2PROSITE-ProRule annotationAdd
BLAST
Domaini282 – 33453SANTPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi36 – 296261Glu-richAdd
BLAST

Sequence similaritiesi

Contains 1 ELM2 domain.PROSITE-ProRule annotation
Contains 1 SANT domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG4329. Eukaryota.
ENOG410Y9DJ. LUCA.
GeneTreeiENSGT00510000046482.
HOVERGENiHBG052923.
InParanoidiQ5UAK0.
OMAiNSNGCSQ.
OrthoDBiEOG7HQN7T.
TreeFamiTF106453.

Family and domain databases

InterProiIPR000949. ELM2_dom.
IPR009057. Homeodomain-like.
IPR031169. MIER1.
IPR001005. SANT/Myb.
IPR017884. SANT_dom.
[Graphical view]
PANTHERiPTHR10865:SF24. PTHR10865:SF24. 1 hit.
PfamiPF01448. ELM2. 1 hit.
PF00249. Myb_DNA-binding. 1 hit.
[Graphical view]
SMARTiSM01189. ELM2. 1 hit.
SM00717. SANT. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
PROSITEiPS51156. ELM2. 1 hit.
PS51293. SANT. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: Q5UAK0-3) [UniParc]FASTAAdd to basket

Also known as: N3 beta

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEPSVESSS PGGSATSEDH EFDPSADMLV HDFDDERTLE EEEMMEGETN
60 70 80 90 100
FSSEIEDLAR EGDMPIHELL SLYGYDSTVR LPEEEEEEEE EEEGEDDEDA
110 120 130 140 150
DNDDNSGCSG ENKEENIKDS SGQEDETQSS NDDPSQSVTS QDAQEIIRPR
160 170 180 190 200
RCKYFDTNSE IEEESEEDED YIPSEDWKKE IMVGSMFQAE IPVGVCRYKE
210 220 230 240 250
NEKVYENDDQ LLWDPECLPE EKVVVFLKDA SRRTGDEKGV EAIPEGSHIK
260 270 280 290 300
DNEQALYELV KCSFDTEEAL RRLRFNVKAA REELSVWTEE ECRNFEQGLK
310 320 330 340 350
AYGKDFHLIQ ANKVRTRSVG ECVAFYYMWK KSERYDFFAQ QTRFGKKKYN
360 370 380 390 400
LHPGVTDYMD RLLDESESAA SSRAPSPPPT ASNSSNSQSE KEDGAVSSRN
410 420 430 440 450
QNGVSSNGPG EILNKEEVKV EGLHVNGPTG GNKKPLLTDM DTNGYEANNL
460 470 480 490 500
TTDPKLAHMT ARNENDFDEK NERPAKRRRI NSSGKESPGS SEFFQEAVSH
510
GKFEEHENTN D
Length:511
Mass (Da):57,908
Last modified:March 21, 2012 - v2
Checksum:i144FBD1A575A557F
GO
Isoform 1 (identifier: Q5UAK0-1) [UniParc]FASTAAdd to basket

Also known as: N4 beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MAEPSVESSSP → MCIRCLCLIGLQTVSGFFSCQITSHLLSLQVQGEYKCGLLCENTSLLIANVRRKVS

Show »
Length:556
Mass (Da):62,980
Checksum:iE2DC03D0C8E06171
GO
Isoform 2 (identifier: Q5UAK0-2) [UniParc]FASTAAdd to basket

Also known as: N1 beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MAE → MFMFNWFTDCLWILFLSNYK

Show »
Length:528
Mass (Da):60,179
Checksum:iA969DB86E9AA82ED
GO
Isoform 4 (identifier: Q5UAK0-4) [UniParc]FASTAAdd to basket

Also known as: N2 beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MAE → ML

Show »
Length:510
Mass (Da):57,821
Checksum:iF0BFBD1A54F81666
GO
Isoform 5 (identifier: Q5UAK0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-181: Missing.

Show »
Length:330
Mass (Da):37,354
Checksum:i0DB7C93B773B8500
GO

Sequence cautioni

The sequence BAC98215.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 181181Missing in isoform 5. 1 PublicationVSP_016174Add
BLAST
Alternative sequencei1 – 1111MAEPSVESSSP → MCIRCLCLIGLQTVSGFFSC QITSHLLSLQVQGEYKCGLL CENTSLLIANVRRKVS in isoform 1. 1 PublicationVSP_042454Add
BLAST
Alternative sequencei1 – 33MAE → MFMFNWFTDCLWILFLSNYK in isoform 2. 2 PublicationsVSP_016175
Alternative sequencei1 – 33MAE → ML in isoform 4. 2 PublicationsVSP_016177

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY769435 mRNA. Translation: AAV37181.1.
AY769436 mRNA. Translation: AAV37182.1.
AY769437 mRNA. Translation: AAV37183.1.
AY769438 mRNA. Translation: AAV37184.1.
AK129405 mRNA. Translation: BAC98215.1. Different initiation.
AK016915 mRNA. Translation: BAB30493.1.
AL844176 Genomic DNA. Translation: CAM27551.1.
AL844176 Genomic DNA. Translation: CAM27556.1.
BC130227 mRNA. Translation: AAI30228.1.
CCDSiCCDS18408.1. [Q5UAK0-2]
CCDS38825.1. [Q5UAK0-3]
CCDS71432.1. [Q5UAK0-1]
RefSeqiNP_001034170.1. NM_001039081.2. [Q5UAK0-3]
NP_001273150.1. NM_001286221.1. [Q5UAK0-1]
NP_001273151.1. NM_001286222.1. [Q5UAK0-2]
NP_001273152.1. NM_001286223.1. [Q5UAK0-4]
NP_081972.2. NM_027696.3. [Q5UAK0-2]
XP_006503464.1. XM_006503401.2. [Q5UAK0-2]
XP_006503465.1. XM_006503402.1. [Q5UAK0-2]
UniGeneiMm.288721.

Genome annotation databases

EnsembliENSMUST00000030247; ENSMUSP00000030247; ENSMUSG00000028522. [Q5UAK0-2]
ENSMUST00000097945; ENSMUSP00000095558; ENSMUSG00000028522. [Q5UAK0-1]
ENSMUST00000106855; ENSMUSP00000102468; ENSMUSG00000028522. [Q5UAK0-5]
ENSMUST00000106857; ENSMUSP00000102470; ENSMUSG00000028522. [Q5UAK0-3]
ENSMUST00000106858; ENSMUSP00000102471; ENSMUSG00000028522. [Q5UAK0-2]
GeneIDi71148.
KEGGimmu:71148.
UCSCiuc008txd.2. mouse. [Q5UAK0-2]
uc008txf.2. mouse. [Q5UAK0-4]
uc008txi.2. mouse. [Q5UAK0-3]
uc012dhr.2. mouse. [Q5UAK0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY769435 mRNA. Translation: AAV37181.1.
AY769436 mRNA. Translation: AAV37182.1.
AY769437 mRNA. Translation: AAV37183.1.
AY769438 mRNA. Translation: AAV37184.1.
AK129405 mRNA. Translation: BAC98215.1. Different initiation.
AK016915 mRNA. Translation: BAB30493.1.
AL844176 Genomic DNA. Translation: CAM27551.1.
AL844176 Genomic DNA. Translation: CAM27556.1.
BC130227 mRNA. Translation: AAI30228.1.
CCDSiCCDS18408.1. [Q5UAK0-2]
CCDS38825.1. [Q5UAK0-3]
CCDS71432.1. [Q5UAK0-1]
RefSeqiNP_001034170.1. NM_001039081.2. [Q5UAK0-3]
NP_001273150.1. NM_001286221.1. [Q5UAK0-1]
NP_001273151.1. NM_001286222.1. [Q5UAK0-2]
NP_001273152.1. NM_001286223.1. [Q5UAK0-4]
NP_081972.2. NM_027696.3. [Q5UAK0-2]
XP_006503464.1. XM_006503401.2. [Q5UAK0-2]
XP_006503465.1. XM_006503402.1. [Q5UAK0-2]
UniGeneiMm.288721.

3D structure databases

ProteinModelPortaliQ5UAK0.
SMRiQ5UAK0. Positions 287-332.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ5UAK0. 1 interaction.
MINTiMINT-4126928.
STRINGi10090.ENSMUSP00000030247.

PTM databases

iPTMnetiQ5UAK0.
PhosphoSiteiQ5UAK0.

Proteomic databases

EPDiQ5UAK0.
MaxQBiQ5UAK0.
PaxDbiQ5UAK0.
PeptideAtlasiQ5UAK0.
PRIDEiQ5UAK0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000030247; ENSMUSP00000030247; ENSMUSG00000028522. [Q5UAK0-2]
ENSMUST00000097945; ENSMUSP00000095558; ENSMUSG00000028522. [Q5UAK0-1]
ENSMUST00000106855; ENSMUSP00000102468; ENSMUSG00000028522. [Q5UAK0-5]
ENSMUST00000106857; ENSMUSP00000102470; ENSMUSG00000028522. [Q5UAK0-3]
ENSMUST00000106858; ENSMUSP00000102471; ENSMUSG00000028522. [Q5UAK0-2]
GeneIDi71148.
KEGGimmu:71148.
UCSCiuc008txd.2. mouse. [Q5UAK0-2]
uc008txf.2. mouse. [Q5UAK0-4]
uc008txi.2. mouse. [Q5UAK0-3]
uc012dhr.2. mouse. [Q5UAK0-1]

Organism-specific databases

CTDi57708.
MGIiMGI:1918398. Mier1.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG4329. Eukaryota.
ENOG410Y9DJ. LUCA.
GeneTreeiENSGT00510000046482.
HOVERGENiHBG052923.
InParanoidiQ5UAK0.
OMAiNSNGCSQ.
OrthoDBiEOG7HQN7T.
TreeFamiTF106453.

Miscellaneous databases

PROiQ5UAK0.
SOURCEiSearch...

Gene expression databases

BgeeiQ5UAK0.
ExpressionAtlasiQ5UAK0. baseline and differential.
GenevisibleiQ5UAK0. MM.

Family and domain databases

InterProiIPR000949. ELM2_dom.
IPR009057. Homeodomain-like.
IPR031169. MIER1.
IPR001005. SANT/Myb.
IPR017884. SANT_dom.
[Graphical view]
PANTHERiPTHR10865:SF24. PTHR10865:SF24. 1 hit.
PfamiPF01448. ELM2. 1 hit.
PF00249. Myb_DNA-binding. 1 hit.
[Graphical view]
SMARTiSM01189. ELM2. 1 hit.
SM00717. SANT. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
PROSITEiPS51156. ELM2. 1 hit.
PS51293. SANT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of the mouse ortholog of mi-er1."
    Thorne L.B., Grant A.L., Paterno G.D., Gillespie L.L.
    DNA Seq. 16:237-240(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), TISSUE SPECIFICITY, FUNCTION.
  2. "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
    DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Embryonic tail.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Strain: C57BL/6J.
    Tissue: Testis.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-482, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-159; SER-165; SER-376; SER-482 AND SER-487, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Heart, Kidney, Lung, Spleen and Testis.

Entry informationi

Entry nameiMIER1_MOUSE
AccessioniPrimary (citable) accession number: Q5UAK0
Secondary accession number(s): A1L3P9
, B1AY29, B1AY34, Q5UAK1, Q5UAK2, Q5UAK3, Q6ZPL6, Q9D402
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: March 21, 2012
Last modified: July 6, 2016
This is version 115 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.