Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mesoderm induction early response protein 1

Gene

Mier1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Transcriptional repressor regulating the expression of a number of genes including SP1 target genes. Probably functions through recruitment of HDAC1 a histone deacetylase involved in chromatin silencing.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionRepressor
Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Mesoderm induction early response protein 1
Short name:
Early response 1
Short name:
Er1
Short name:
Mi-er1
Gene namesi
Name:Mier1
Synonyms:Kiaa1610
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:1918398 Mier1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001971421 – 511Mesoderm induction early response protein 1Add BLAST511

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei10PhosphoserineBy similarity1
Modified residuei140PhosphoserineBy similarity1
Modified residuei154PhosphotyrosineBy similarity1
Modified residuei159PhosphoserineCombined sources1
Modified residuei165PhosphoserineCombined sources1
Cross-linki238Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei366PhosphoserineBy similarity1
Modified residuei368PhosphoserineBy similarity1
Modified residuei376PhosphoserineCombined sources1
Cross-linki419Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei482PhosphoserineCombined sources1
Modified residuei487PhosphoserineCombined sources1
Modified residuei490PhosphoserineBy similarity1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ5UAK0
PaxDbiQ5UAK0
PeptideAtlasiQ5UAK0
PRIDEiQ5UAK0

PTM databases

iPTMnetiQ5UAK0
PhosphoSitePlusiQ5UAK0

Expressioni

Tissue specificityi

Ubiquitously expressed. Isoform 1 is only expressed in testis.1 Publication

Gene expression databases

BgeeiENSMUSG00000028522
ExpressionAtlasiQ5UAK0 baseline and differential
GenevisibleiQ5UAK0 MM

Interactioni

Subunit structurei

Interacts with HDAC1. Part of a complex containing at least CDYL, MIER1, MIER2, HDAC1 and HDAC2.By similarity

GO - Molecular functioni

Protein-protein interaction databases

IntActiQ5UAK0, 1 interactor
MINTiQ5UAK0
STRINGi10090.ENSMUSP00000030247

Structurei

3D structure databases

ProteinModelPortaliQ5UAK0
SMRiQ5UAK0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini179 – 277ELM2PROSITE-ProRule annotationAdd BLAST99
Domaini282 – 334SANTPROSITE-ProRule annotationAdd BLAST53

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi36 – 296Glu-richAdd BLAST261

Phylogenomic databases

eggNOGiKOG4329 Eukaryota
ENOG410Y9DJ LUCA
GeneTreeiENSGT00510000046482
HOVERGENiHBG052923
InParanoidiQ5UAK0
OMAiVEGLHVN
OrthoDBiEOG091G0BKH
TreeFamiTF106453

Family and domain databases

InterProiView protein in InterPro
IPR000949 ELM2_dom
IPR009057 Homeobox-like_sf
IPR031169 MIER1
IPR001005 SANT/Myb
IPR017884 SANT_dom
PANTHERiPTHR10865:SF24 PTHR10865:SF24, 1 hit
PfamiView protein in Pfam
PF01448 ELM2, 1 hit
PF00249 Myb_DNA-binding, 1 hit
SMARTiView protein in SMART
SM01189 ELM2, 1 hit
SM00717 SANT, 1 hit
SUPFAMiSSF46689 SSF46689, 1 hit
PROSITEiView protein in PROSITE
PS51156 ELM2, 1 hit
PS51293 SANT, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: Q5UAK0-3) [UniParc]FASTAAdd to basket
Also known as: N3 beta

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEPSVESSS PGGSATSEDH EFDPSADMLV HDFDDERTLE EEEMMEGETN
60 70 80 90 100
FSSEIEDLAR EGDMPIHELL SLYGYDSTVR LPEEEEEEEE EEEGEDDEDA
110 120 130 140 150
DNDDNSGCSG ENKEENIKDS SGQEDETQSS NDDPSQSVTS QDAQEIIRPR
160 170 180 190 200
RCKYFDTNSE IEEESEEDED YIPSEDWKKE IMVGSMFQAE IPVGVCRYKE
210 220 230 240 250
NEKVYENDDQ LLWDPECLPE EKVVVFLKDA SRRTGDEKGV EAIPEGSHIK
260 270 280 290 300
DNEQALYELV KCSFDTEEAL RRLRFNVKAA REELSVWTEE ECRNFEQGLK
310 320 330 340 350
AYGKDFHLIQ ANKVRTRSVG ECVAFYYMWK KSERYDFFAQ QTRFGKKKYN
360 370 380 390 400
LHPGVTDYMD RLLDESESAA SSRAPSPPPT ASNSSNSQSE KEDGAVSSRN
410 420 430 440 450
QNGVSSNGPG EILNKEEVKV EGLHVNGPTG GNKKPLLTDM DTNGYEANNL
460 470 480 490 500
TTDPKLAHMT ARNENDFDEK NERPAKRRRI NSSGKESPGS SEFFQEAVSH
510
GKFEEHENTN D
Length:511
Mass (Da):57,908
Last modified:March 21, 2012 - v2
Checksum:i144FBD1A575A557F
GO
Isoform 1 (identifier: Q5UAK0-1) [UniParc]FASTAAdd to basket
Also known as: N4 beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MAEPSVESSSP → MCIRCLCLIGLQTVSGFFSCQITSHLLSLQVQGEYKCGLLCENTSLLIANVRRKVS

Show »
Length:556
Mass (Da):62,980
Checksum:iE2DC03D0C8E06171
GO
Isoform 2 (identifier: Q5UAK0-2) [UniParc]FASTAAdd to basket
Also known as: N1 beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MAE → MFMFNWFTDCLWILFLSNYK

Show »
Length:528
Mass (Da):60,179
Checksum:iA969DB86E9AA82ED
GO
Isoform 4 (identifier: Q5UAK0-4) [UniParc]FASTAAdd to basket
Also known as: N2 beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MAE → ML

Show »
Length:510
Mass (Da):57,821
Checksum:iF0BFBD1A54F81666
GO
Isoform 5 (identifier: Q5UAK0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-181: Missing.

Show »
Length:330
Mass (Da):37,354
Checksum:i0DB7C93B773B8500
GO

Sequence cautioni

The sequence BAC98215 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0161741 – 181Missing in isoform 5. 1 PublicationAdd BLAST181
Alternative sequenceiVSP_0424541 – 11MAEPSVESSSP → MCIRCLCLIGLQTVSGFFSC QITSHLLSLQVQGEYKCGLL CENTSLLIANVRRKVS in isoform 1. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_0161751 – 3MAE → MFMFNWFTDCLWILFLSNYK in isoform 2. 2 Publications3
Alternative sequenceiVSP_0161771 – 3MAE → ML in isoform 4. 2 Publications3

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY769435 mRNA Translation: AAV37181.1
AY769436 mRNA Translation: AAV37182.1
AY769437 mRNA Translation: AAV37183.1
AY769438 mRNA Translation: AAV37184.1
AK129405 mRNA Translation: BAC98215.1 Different initiation.
AK016915 mRNA Translation: BAB30493.1
AL844176 Genomic DNA No translation available.
BC130227 mRNA Translation: AAI30228.1
CCDSiCCDS18408.1 [Q5UAK0-2]
CCDS38825.1 [Q5UAK0-3]
CCDS71432.1 [Q5UAK0-1]
RefSeqiNP_001034170.1, NM_001039081.2 [Q5UAK0-3]
NP_001273150.1, NM_001286221.1 [Q5UAK0-1]
NP_001273151.1, NM_001286222.1 [Q5UAK0-2]
NP_001273152.1, NM_001286223.1 [Q5UAK0-4]
NP_081972.2, NM_027696.3 [Q5UAK0-2]
XP_006503464.1, XM_006503401.3 [Q5UAK0-2]
XP_006503465.1, XM_006503402.1 [Q5UAK0-2]
UniGeneiMm.288721

Genome annotation databases

EnsembliENSMUST00000030247; ENSMUSP00000030247; ENSMUSG00000028522 [Q5UAK0-2]
ENSMUST00000097945; ENSMUSP00000095558; ENSMUSG00000028522 [Q5UAK0-1]
ENSMUST00000106855; ENSMUSP00000102468; ENSMUSG00000028522 [Q5UAK0-5]
ENSMUST00000106857; ENSMUSP00000102470; ENSMUSG00000028522 [Q5UAK0-3]
ENSMUST00000106858; ENSMUSP00000102471; ENSMUSG00000028522 [Q5UAK0-2]
GeneIDi71148
KEGGimmu:71148
UCSCiuc008txd.2 mouse [Q5UAK0-2]
uc008txf.2 mouse [Q5UAK0-4]
uc008txi.2 mouse [Q5UAK0-3]
uc012dhr.2 mouse [Q5UAK0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMIER1_MOUSE
AccessioniPrimary (citable) accession number: Q5UAK0
Secondary accession number(s): A1L3P9
, B1AY29, B1AY34, Q5UAK1, Q5UAK2, Q5UAK3, Q6ZPL6, Q9D402
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: March 21, 2012
Last modified: May 23, 2018
This is version 130 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health