Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

E3 ubiquitin-protein ligase UBR3

Gene

Ubr3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Does not bind to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri118 – 18972UBR-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1306 – 136459RING-type; degenerateAdd
BLAST

GO - Molecular functioni

  • ligase activity Source: UniProtKB-KW
  • ubiquitin protein ligase activity Source: MGI
  • ubiquitin-protein transferase activity Source: UniProtKB
  • zinc ion binding Source: InterPro

GO - Biological processi

  • embryo development Source: UniProtKB
  • in utero embryonic development Source: MGI
  • olfactory behavior Source: MGI
  • sensory perception of smell Source: UniProtKB
  • suckling behavior Source: UniProtKB
  • ubiquitin-dependent protein catabolic process Source: UniProtKB
  • ubiquitin-dependent protein catabolic process via the N-end rule pathway Source: GO_Central
Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase UBR3 (EC:6.3.2.-)
Alternative name(s):
N-recognin-3
Ubiquitin-protein ligase E3-alpha-3
Ubiquitin-protein ligase E3-alpha-III
Zinc finger protein 650
Gene namesi
Name:Ubr3
Synonyms:Kiaa2024, Zfp650, Znf650
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:1861100. Ubr3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei761 – 78121HelicalSequence analysisAdd
BLAST
Transmembranei919 – 93921HelicalSequence analysisAdd
BLAST
Transmembranei1807 – 182721HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Disruption phenotypei

Knockout mice for Ubr3 in a B6-enriched background exhibited neonatal lethality associated with suckling impairment, but can be partially rescued if the litter size is reduced. Survived adult knockout mice for Ubr3 had female-specific behavioral anosmia (decreased sense of smell).1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 18891889E3 ubiquitin-protein ligase UBR3PRO_0000278185Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei343 – 3431PhosphoserineCombined sources
Modified residuei344 – 3441PhosphoserineCombined sources
Modified residuei1199 – 11991PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ5U430.
PaxDbiQ5U430.
PeptideAtlasiQ5U430.
PRIDEiQ5U430.

PTM databases

iPTMnetiQ5U430.
PhosphoSiteiQ5U430.

Expressioni

Tissue specificityi

Expressed in numerous cells of the smell, touch, vision, hearing and taste senses. Expressed in cells of the olfactory pathway, including the olfactory cell layer of the main olfactory epithelium (MOE), a mitral neuron cell layer of the olfactory bulb (OB), and a pyramidal cell layer of the piriform cortex of the olfactory cortex (OC). Expressed in the vomeronasal sensory epithelium of the vomeronasal organ (VNO) and the mitral cells of the accessory olfactory bulb. Expressed in tactile tissues, including the dorsal root ganglion, trigeminal ganglion and follicle-sinus complexes. Expressed in cells between hair follicle and sinus and also in the region of the rete ridge collar. Expressed in taste buds of the fungiform, circumvallate, and foliate papillae. Expressed in the spiral ganglion, the organ of Corti of the cochlea in the inner ear, in the sensory epithelium of macula and vestibular ganglion of the balancing system (at protein level). Expressed in the liver and skeletal muscle.1 Publication

Gene expression databases

BgeeiENSMUSG00000044308.
ExpressionAtlasiQ5U430. baseline and differential.
GenevisibleiQ5U430. MM.

Interactioni

Subunit structurei

Interacts with UBE2A and UBE2B.1 Publication

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000060159.

Structurei

3D structure databases

ProteinModelPortaliQ5U430.
SMRiQ5U430. Positions 119-188.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili1167 – 119933Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi2 – 7675Ala-richAdd
BLAST
Compositional biasi1767 – 180943Cys-richAdd
BLAST

Sequence similaritiesi

Belongs to the UBR1 family.Curated
Contains 1 RING-type zinc finger.Curated
Contains 1 UBR-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri118 – 18972UBR-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1306 – 136459RING-type; degenerateAdd
BLAST

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix, Zinc-finger

Phylogenomic databases

eggNOGiKOG1139. Eukaryota.
ENOG410XRM3. LUCA.
GeneTreeiENSGT00530000063055.
HOGENOMiHOG000231987.
HOVERGENiHBG108647.
InParanoidiQ5U430.
KOiK11978.
PhylomeDBiQ5U430.
TreeFamiTF323875.

Family and domain databases

InterProiIPR003126. Znf_UBR.
[Graphical view]
PfamiPF02207. zf-UBR. 1 hit.
[Graphical view]
SMARTiSM00396. ZnF_UBR1. 1 hit.
[Graphical view]
PROSITEiPS51157. ZF_UBR. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5U430-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAAAAAAV GDPQPPQPEA PAQGLALDKA ATAAHLKAAL SRPDNRAGAE
60 70 80 90 100
ELQALLERVL NAERPLAGAA GGEEAAGGGG GGPGEAEEDA LEWCKCLLAG
110 120 130 140 150
GGGYEEFCAA VRAYDPAALC GLVWTANFVA YRCRTCGISP CMSLCAECFH
160 170 180 190 200
QGDHTGHDFN MFRSQAGGAC DCGDSNVMRE SGFCRRHQIK SSSNIPCVPK
210 220 230 240 250
DLLMMSEFVL PRFIFCLIQY LREGYNEPAA DAPSEKDLNK VLQLLEPQIS
260 270 280 290 300
FLEDLTKMGG AMRSVLTQVL TNQQNYKDLT AGLGENACAK KSHEKYLIAL
310 320 330 340 350
KSSGLTYPED KLVYGVQEPA AGTSTLAAQG FAGATGTLGQ IDSSDEEDQD
360 370 380 390 400
GSQGLGKRKR VKLSSGTKDQ SIMDVLKHKS FLEELLFWTI KYEFPQKMVT
410 420 430 440 450
FLLNMLPDQE YKVAFTKTFV QHYAFIMKTL KKSHESDTMS NRIVHISVQL
460 470 480 490 500
FSNEELARQV TEECQLLDIM VTVLLYMMES CLIKSELQDE ENSLHVVVNC
510 520 530 540 550
GEALLKNNTY WPLVSDFINI LSHQSVAQRF LEDHGLLVTW MNFVSFFQGM
560 570 580 590 600
NLNKRELNEH VEFESQTYYA AFAAELEACA QPMWGLLSHC KVRETQEYTR
610 620 630 640 650
NVVRYCLEAL QDWFDAINFV DEPAPNQVTF HLPLHRYYAM FLSKAVKCQE
660 670 680 690 700
LDLDSLLPDQ EMLMKLMIHP LQIQASLAEI HSNMWVRNGL QIKGQAMTYV
710 720 730 740 750
QSHFCNSMID PDIYLLQVCA SRLDPDYFIS SVFERFKVVD LLTMASQHHN
760 770 780 790 800
MVLDVEHERS MLEGALTFLV ILLSLRLHLG MSDDDILRAE MVAQLCMNDR
810 820 830 840 850
THSSLLDLIP ENPNPKSGII PGSYSFESVL SAVADFRAPI FEPGGSMQQG
860 870 880 890 900
MYTPKAEVWD QEFDPVMVIL RTVYRRDVQS AMDRYTAFLK QSGKFPGNPW
910 920 930 940 950
PPYKKRTSLH PSYKGLMRLL HCKTLHIVLF TLLYKILMDH QNLSEHVLCM
960 970 980 990 1000
VLYLIELGLE NSADDDSEEE VSMGGPERCH DSWFPGSNLV SNMRHFINYV
1010 1020 1030 1040 1050
RVRVPETAPE LKRDPLASTS SDALDSLQNS GTAQVFSLVA ERRKKFQEII
1060 1070 1080 1090 1100
NRSNSEANQV VRPKIPSKWS APGSSPQLTT AILEIKESIL SLLIKLHHKL
1110 1120 1130 1140 1150
SGKQNSYYPP WLDDIEVLIQ PEIPKYNHGD GITAVERILL KAAVQSRMNK
1160 1170 1180 1190 1200
RIIEEICRKV TPPVPPKKIT AAEKKTLDKE ERRQKARERQ QKLLAEFASR
1210 1220 1230 1240 1250
QKSFMETAMD VDSPENDIPM EITTAEPQVS EAVYDCVICG QSGPSSEDRP
1260 1270 1280 1290 1300
TGLVVLLQAS SVLGQCRDNA EPKKLPIAEE EQIYPWDTCA AVHDVRLSLL
1310 1320 1330 1340 1350
QRYFKDSSCL LAVSIGWEGG VYVQTCGHTL HIDCHKSYME SLRNDQVLQG
1360 1370 1380 1390 1400
FSVDKGEFTC PLCRQFANSV LPCYPGSNVE NNLWQRPCNK STQDLIKEVE
1410 1420 1430 1440 1450
ELQGRPGAFP SETNLSKEME SVMKDIKNTT QKKYRDYSKT PGSPDNEFLF
1460 1470 1480 1490 1500
MYSVARTNLE LELIHRGGSL CSGGPSTAGK RSCLNQLFHV LALHMRLYTI
1510 1520 1530 1540 1550
DSEYNPWKKL TQLVEDMNSQ VGNEDQQPEV PILYHDVTSL LLIQILMMPQ
1560 1570 1580 1590 1600
PLRKEHFTCI VKVLFTLLYT QALAALSVKG TEEDRSAWKH AGALRKDTCD
1610 1620 1630 1640 1650
AEKCYEVLLS FVISELSKGK LYYEEGAQEC AMVSPIAWSP ESMERYIQDF
1660 1670 1680 1690 1700
CLPFLRVSSL LQHHLFGEDL PSCQEEEEFS VLASCLGLLP TFYQTDHPFI
1710 1720 1730 1740 1750
SASCLDWPVA AFDIITQWCF EITSFTERHA EQGKALLIQE SRWKLPHLLQ
1760 1770 1780 1790 1800
LPENYNTIFQ YYHRKTCSVC TKVPKDPAVC LVCGTFVCLK GLCCKQQSYC
1810 1820 1830 1840 1850
ECVLHSQNCG AGTGIFLLIN ASVIIIIRGH RFCLWGSVYL DAHGEEDRDL
1860 1870 1880
RRGKPLYICE ERYRVLEQQW VSHTFDHINK RWGPHYNGL
Length:1,889
Mass (Da):212,757
Last modified:January 15, 2008 - v3
Checksum:iF2D5B94FEE7ED562
GO
Isoform 2 (identifier: Q5U430-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1494: Missing.

Show »
Length:395
Mass (Da):45,515
Checksum:iE7B52615AD9DE6DF
GO
Isoform 3 (identifier: Q5U430-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1735-1769: ALLIQESRWKLPHLLQLPENYNTIFQYYHRKTCSV → VWREVGGNVLLGRGLMEEVKSRSLVAAGFKLIKLK
     1770-1889: Missing.

Note: No experimental confirmation available.
Show »
Length:1,769
Mass (Da):198,625
Checksum:i8E1CEFD0DCA94F03
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1269 – 12691N → S in ABK59000 (PubMed:17462990).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 14941494Missing in isoform 2. 1 PublicationVSP_023143Add
BLAST
Alternative sequencei1735 – 176935ALLIQ…KTCSV → VWREVGGNVLLGRGLMEEVK SRSLVAAGFKLIKLK in isoform 3. 1 PublicationVSP_023144Add
BLAST
Alternative sequencei1770 – 1889120Missing in isoform 3. 1 PublicationVSP_023145Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ924536 mRNA. Translation: ABK59000.1.
AL929249 Genomic DNA. Translation: CAM19287.3.
BC085286 mRNA. Translation: AAH85286.1.
AK173334 mRNA. Translation: BAD32612.1.
CCDSiCCDS16104.2. [Q5U430-1]
RefSeqiNP_808451.2. NM_177783.6. [Q5U430-1]
UniGeneiMm.314576.
Mm.406897.
Mm.449153.

Genome annotation databases

EnsembliENSMUST00000055758; ENSMUSP00000060159; ENSMUSG00000044308. [Q5U430-1]
GeneIDi68795.
KEGGimmu:68795.
UCSCiuc008jzb.3. mouse. [Q5U430-1]
uc008jzc.2. mouse. [Q5U430-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ924536 mRNA. Translation: ABK59000.1.
AL929249 Genomic DNA. Translation: CAM19287.3.
BC085286 mRNA. Translation: AAH85286.1.
AK173334 mRNA. Translation: BAD32612.1.
CCDSiCCDS16104.2. [Q5U430-1]
RefSeqiNP_808451.2. NM_177783.6. [Q5U430-1]
UniGeneiMm.314576.
Mm.406897.
Mm.449153.

3D structure databases

ProteinModelPortaliQ5U430.
SMRiQ5U430. Positions 119-188.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000060159.

PTM databases

iPTMnetiQ5U430.
PhosphoSiteiQ5U430.

Proteomic databases

MaxQBiQ5U430.
PaxDbiQ5U430.
PeptideAtlasiQ5U430.
PRIDEiQ5U430.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000055758; ENSMUSP00000060159; ENSMUSG00000044308. [Q5U430-1]
GeneIDi68795.
KEGGimmu:68795.
UCSCiuc008jzb.3. mouse. [Q5U430-1]
uc008jzc.2. mouse. [Q5U430-2]

Organism-specific databases

CTDi130507.
MGIiMGI:1861100. Ubr3.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG1139. Eukaryota.
ENOG410XRM3. LUCA.
GeneTreeiENSGT00530000063055.
HOGENOMiHOG000231987.
HOVERGENiHBG108647.
InParanoidiQ5U430.
KOiK11978.
PhylomeDBiQ5U430.
TreeFamiTF323875.

Enzyme and pathway databases

UniPathwayiUPA00143.

Miscellaneous databases

ChiTaRSiUbr3. mouse.
PROiQ5U430.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000044308.
ExpressionAtlasiQ5U430. baseline and differential.
GenevisibleiQ5U430. MM.

Family and domain databases

InterProiIPR003126. Znf_UBR.
[Graphical view]
PfamiPF02207. zf-UBR. 1 hit.
[Graphical view]
SMARTiSM00396. ZnF_UBR1. 1 hit.
[Graphical view]
PROSITEiPS51157. ZF_UBR. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiUBR3_MOUSE
AccessioniPrimary (citable) accession number: Q5U430
Secondary accession number(s): A2AV04, A6MFP4, Q69Z32
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: January 15, 2008
Last modified: September 7, 2016
This is version 101 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.