Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho GTPase-activating protein 24

Gene

Arhgap24

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Rho GTPase-activating protein involved in cell polarity, cell morphology and cytoskeletal organization. Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state. Controls actin remodeling by inactivating Rac downstream of Rho leading to suppress leading edge protrusion and promotes cell retraction to achieve cellular polarity. Able to suppress RAC1 and CDC42 activity in vitro. Overexpression induces cell rounding with partial or complete disruption of actin stress fibers and formation of membrane ruffles, lamellipodia, and filopodia. Isoform 2 is a vascular cell-specific GAP involved in modulation of angiogenesis (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein, GTPase activation
Biological processAngiogenesis, Differentiation

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 24
Alternative name(s):
Down-regulated in nephrectomized rat kidney #2
Rho-type GTPase-activating protein 24
Gene namesi
ORF Names:DR-NR#2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi1306669 Arhgap24

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002804751 – 748Rho GTPase-activating protein 24Add BLAST748

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei369PhosphoserineCombined sources1
Modified residuei391PhosphoserineCombined sources1
Modified residuei396PhosphoserineBy similarity1
Modified residuei398PhosphoserineCombined sources1
Modified residuei402PhosphoserineBy similarity1
Modified residuei413PhosphoserineBy similarity1
Modified residuei415PhosphoserineCombined sources1
Modified residuei437PhosphoserineBy similarity1
Modified residuei452PhosphothreonineBy similarity1
Modified residuei495PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated by ROCK, leading to activate the RacGAP activity.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ5U2Z7
PRIDEiQ5U2Z7

PTM databases

iPTMnetiQ5U2Z7
PhosphoSitePlusiQ5U2Z7

Expressioni

Inductioni

Down-regulated after nephrectomy.1 Publication

Gene expression databases

BgeeiENSRNOG00000056944

Interactioni

Subunit structurei

Interacts with FLNA.By similarity

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000002857

Structurei

3D structure databases

ProteinModelPortaliQ5U2Z7
SMRiQ5U2Z7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini18 – 124PHPROSITE-ProRule annotationAdd BLAST107
Domaini134 – 328Rho-GAPPROSITE-ProRule annotationAdd BLAST195

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili649 – 729Sequence analysisAdd BLAST81

Domaini

The coiled coil domain mediates the interaction with FLNA leading to its recruitment to lamellae.By similarity

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG4270 Eukaryota
ENOG410XRR2 LUCA
HOGENOMiHOG000232151
HOVERGENiHBG058875
InParanoidiQ5U2Z7
KOiK20642
OMAiLLKYICR
PhylomeDBiQ5U2Z7
TreeFamiTF323577

Family and domain databases

Gene3Di1.10.555.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom
PfamiView protein in Pfam
PF00169 PH, 1 hit
PF00620 RhoGAP, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00324 RhoGAP, 1 hit
SUPFAMiSSF48350 SSF48350, 1 hit
PROSITEiView protein in PROSITE
PS50003 PH_DOMAIN, 1 hit
PS50238 RHOGAP, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5U2Z7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEENCDSTEN PHSQGRQNAT KCGWLRKQGG FVKTWHTRWF VLKGDQLHYF
60 70 80 90 100
KDEDETKPLG TIFLPGNKVI EHPCNEESPG KFLFEVVPGG ERDRMTANHE
110 120 130 140 150
SYLLMASTQN DMEDWVKSIR RVIWGPFGGG IFGQKLEDTV RYEKRYGNRL
160 170 180 190 200
APMLVEQCVD FIRQRGLKEE GLFRLPGQAN LVKELQDAFD CGEKPSFDSN
210 220 230 240 250
TDVHTVASLL KLYLRELPEP VVPYAKYEDF LSCATLLSKE EEAGVKELTK
260 270 280 290 300
QVKSLPVVNY NLLKYICRFL DEVQSYSGVN KMSAQNLATV FGPNILRPKV
310 320 330 340 350
EDPLTIMEGT VVVQQLMSVM ISKHDRLFPK DTEPQSKPQE GPNSNNNDGH
360 370 380 390 400
KKVTMGQLQN KENNNTKESP VRRCSWDKPE SPQRSSMDNG SPTALSGSKT
410 420 430 440 450
NSPRNSIHKL DVSRSPPLTV KKNPAFNKGS GIVTNGSFSS SNAEGVEKTQ
460 470 480 490 500
TTPNGSLQAR RTSSLKSSGT KMGTHSVQNG TVRMGILNTD TLGNSLNGRS
510 520 530 540 550
MSWLPNGYVT LRDNKQKEPA GESGQHNRLS TYDNVHQQFS LMNLDDKHSV
560 570 580 590 600
DSATWSTSSC EISLPENSNS CRSSTTTCPE QDFYGGNFED PVLDGPPQDD
610 620 630 640 650
LSHPGDYENK SDRRSVGGRS SRATSSSDNS ETFVGNTSSN HSALHSLVSS
660 670 680 690 700
LKQEMTKQKI EYESRIKSLE QRNLTLETEM LNLHDELDQE RKKFTMIEIK
710 720 730 740
MRNAERAKED AEKRNDMLQK EMEQFFSTFG DLTVEPRRSE RGNTIWIQ
Length:748
Mass (Da):84,144
Last modified:March 20, 2007 - v2
Checksum:iCEEC20AD771784A7
GO
Isoform 2 (identifier: Q5U2Z7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-91: Missing.
     92-129: RDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGG → MPEDRNSGGRPSGALASTPFIPKTTYRRIKRCFSFRK

Show »
Length:656
Mass (Da):73,489
Checksum:i6F53FA78266A7FB0
GO
Isoform 3 (identifier: Q5U2Z7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-152: Missing.

Note: No experimental confirmation available.
Show »
Length:596
Mass (Da):66,584
Checksum:i75A5C41F7AA9C476
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti355M → I in BAD23895 (PubMed:15200410).Curated1
Sequence conflicti430S → R in BAD23895 (PubMed:15200410).Curated1
Sequence conflicti443A → G in BAD23895 (PubMed:15200410).Curated1
Sequence conflicti462T → S in BAD23895 (PubMed:15200410).Curated1
Sequence conflicti466K → E in BAD23895 (PubMed:15200410).Curated1
Sequence conflicti472M → W in BAD23895 (PubMed:15200410).Curated1
Sequence conflicti486I → Y in BAD23895 (PubMed:15200410).Curated1
Sequence conflicti520A → G in BAD23895 (PubMed:15200410).Curated1
Sequence conflicti524G → S in BAD23895 (PubMed:15200410).Curated1
Sequence conflicti549S → R in BAD23895 (PubMed:15200410).Curated1
Sequence conflicti631E → D in BAD23895 (PubMed:15200410).Curated1
Sequence conflicti634V → F in BAD23895 (PubMed:15200410).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0237221 – 152Missing in isoform 3. 1 PublicationAdd BLAST152
Alternative sequenceiVSP_0237231 – 91Missing in isoform 2. 1 PublicationAdd BLAST91
Alternative sequenceiVSP_02372492 – 129RDRMT…GPFGG → MPEDRNSGGRPSGALASTPF IPKTTYRRIKRCFSFRK in isoform 2. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB108670 mRNA Translation: BAD23895.1
BC085797 mRNA Translation: AAH85797.1
CB609913 mRNA No translation available.
RefSeqiNP_001012032.1, NM_001012032.1 [Q5U2Z7-2]
UniGeneiRn.24657

Genome annotation databases

GeneIDi305156
KEGGirno:305156

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRHG24_RAT
AccessioniPrimary (citable) accession number: Q5U2Z7
Secondary accession number(s): Q6I7R2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 20, 2007
Last modified: May 23, 2018
This is version 112 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health