Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho GTPase-activating protein 24

Gene

Arhgap24

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Rho GTPase-activating protein involved in cell polarity, cell morphology and cytoskeletal organization. Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state. Controls actin remodeling by inactivating Rac downstream of Rho leading to suppress leading edge protrusion and promotes cell retraction to achieve cellular polarity. Able to suppress RAC1 and CDC42 activity in vitro. Overexpression induces cell rounding with partial or complete disruption of actin stress fibers and formation of membrane ruffles, lamellipodia, and filopodia. Isoform 2 is a vascular cell-specific GAP involved in modulation of angiogenesis (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, GTPase activation

Keywords - Biological processi

Angiogenesis, Differentiation

Enzyme and pathway databases

ReactomeiR-RNO-194840. Rho GTPase cycle.

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 24
Alternative name(s):
Down-regulated in nephrectomized rat kidney #2
Rho-type GTPase-activating protein 24
Gene namesi
ORF Names:DR-NR#2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi1306669. Arhgap24.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 748748Rho GTPase-activating protein 24PRO_0000280475Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei369 – 3691PhosphoserineCombined sources
Modified residuei391 – 3911PhosphoserineCombined sources
Modified residuei396 – 3961PhosphoserineBy similarity
Modified residuei398 – 3981PhosphoserineCombined sources
Modified residuei402 – 4021PhosphoserineBy similarity
Modified residuei413 – 4131PhosphoserineBy similarity
Modified residuei415 – 4151PhosphoserineCombined sources
Modified residuei437 – 4371PhosphoserineBy similarity
Modified residuei452 – 4521PhosphothreonineBy similarity
Modified residuei495 – 4951PhosphoserineBy similarity

Post-translational modificationi

Phosphorylated by ROCK, leading to activate the RacGAP activity.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ5U2Z7.
PRIDEiQ5U2Z7.

PTM databases

iPTMnetiQ5U2Z7.
PhosphoSiteiQ5U2Z7.

Expressioni

Inductioni

Down-regulated after nephrectomy.1 Publication

Gene expression databases

BgeeiENSRNOG00000002095.
ExpressionAtlasiQ5U2Z7. differential.

Interactioni

Subunit structurei

Interacts with FLNA.By similarity

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000002857.

Structurei

3D structure databases

ProteinModelPortaliQ5U2Z7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini18 – 124107PHPROSITE-ProRule annotationAdd
BLAST
Domaini134 – 328195Rho-GAPPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili649 – 72981Sequence analysisAdd
BLAST

Domaini

The coiled coil domain mediates the interaction with FLNA leading to its recruitment to lamellae.By similarity

Sequence similaritiesi

Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 Rho-GAP domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG4270. Eukaryota.
ENOG410XRR2. LUCA.
HOGENOMiHOG000232151.
HOVERGENiHBG058875.
InParanoidiQ5U2Z7.
OMAiETFVGNN.
PhylomeDBiQ5U2Z7.
TreeFamiTF323577.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50238. RHOGAP. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5U2Z7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEENCDSTEN PHSQGRQNAT KCGWLRKQGG FVKTWHTRWF VLKGDQLHYF
60 70 80 90 100
KDEDETKPLG TIFLPGNKVI EHPCNEESPG KFLFEVVPGG ERDRMTANHE
110 120 130 140 150
SYLLMASTQN DMEDWVKSIR RVIWGPFGGG IFGQKLEDTV RYEKRYGNRL
160 170 180 190 200
APMLVEQCVD FIRQRGLKEE GLFRLPGQAN LVKELQDAFD CGEKPSFDSN
210 220 230 240 250
TDVHTVASLL KLYLRELPEP VVPYAKYEDF LSCATLLSKE EEAGVKELTK
260 270 280 290 300
QVKSLPVVNY NLLKYICRFL DEVQSYSGVN KMSAQNLATV FGPNILRPKV
310 320 330 340 350
EDPLTIMEGT VVVQQLMSVM ISKHDRLFPK DTEPQSKPQE GPNSNNNDGH
360 370 380 390 400
KKVTMGQLQN KENNNTKESP VRRCSWDKPE SPQRSSMDNG SPTALSGSKT
410 420 430 440 450
NSPRNSIHKL DVSRSPPLTV KKNPAFNKGS GIVTNGSFSS SNAEGVEKTQ
460 470 480 490 500
TTPNGSLQAR RTSSLKSSGT KMGTHSVQNG TVRMGILNTD TLGNSLNGRS
510 520 530 540 550
MSWLPNGYVT LRDNKQKEPA GESGQHNRLS TYDNVHQQFS LMNLDDKHSV
560 570 580 590 600
DSATWSTSSC EISLPENSNS CRSSTTTCPE QDFYGGNFED PVLDGPPQDD
610 620 630 640 650
LSHPGDYENK SDRRSVGGRS SRATSSSDNS ETFVGNTSSN HSALHSLVSS
660 670 680 690 700
LKQEMTKQKI EYESRIKSLE QRNLTLETEM LNLHDELDQE RKKFTMIEIK
710 720 730 740
MRNAERAKED AEKRNDMLQK EMEQFFSTFG DLTVEPRRSE RGNTIWIQ
Length:748
Mass (Da):84,144
Last modified:March 20, 2007 - v2
Checksum:iCEEC20AD771784A7
GO
Isoform 2 (identifier: Q5U2Z7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-91: Missing.
     92-129: RDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGG → MPEDRNSGGRPSGALASTPFIPKTTYRRIKRCFSFRK

Show »
Length:656
Mass (Da):73,489
Checksum:i6F53FA78266A7FB0
GO
Isoform 3 (identifier: Q5U2Z7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-152: Missing.

Note: No experimental confirmation available.
Show »
Length:596
Mass (Da):66,584
Checksum:i75A5C41F7AA9C476
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti355 – 3551M → I in BAD23895 (PubMed:15200410).Curated
Sequence conflicti430 – 4301S → R in BAD23895 (PubMed:15200410).Curated
Sequence conflicti443 – 4431A → G in BAD23895 (PubMed:15200410).Curated
Sequence conflicti462 – 4621T → S in BAD23895 (PubMed:15200410).Curated
Sequence conflicti466 – 4661K → E in BAD23895 (PubMed:15200410).Curated
Sequence conflicti472 – 4721M → W in BAD23895 (PubMed:15200410).Curated
Sequence conflicti486 – 4861I → Y in BAD23895 (PubMed:15200410).Curated
Sequence conflicti520 – 5201A → G in BAD23895 (PubMed:15200410).Curated
Sequence conflicti524 – 5241G → S in BAD23895 (PubMed:15200410).Curated
Sequence conflicti549 – 5491S → R in BAD23895 (PubMed:15200410).Curated
Sequence conflicti631 – 6311E → D in BAD23895 (PubMed:15200410).Curated
Sequence conflicti634 – 6341V → F in BAD23895 (PubMed:15200410).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 152152Missing in isoform 3. 1 PublicationVSP_023722Add
BLAST
Alternative sequencei1 – 9191Missing in isoform 2. 1 PublicationVSP_023723Add
BLAST
Alternative sequencei92 – 12938RDRMT…GPFGG → MPEDRNSGGRPSGALASTPF IPKTTYRRIKRCFSFRK in isoform 2. 1 PublicationVSP_023724Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB108670 mRNA. Translation: BAD23895.1.
BC085797 mRNA. Translation: AAH85797.1.
CB609913 mRNA. No translation available.
RefSeqiNP_001012032.1. NM_001012032.1. [Q5U2Z7-2]
UniGeneiRn.24657.

Genome annotation databases

GeneIDi305156.
KEGGirno:305156.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB108670 mRNA. Translation: BAD23895.1.
BC085797 mRNA. Translation: AAH85797.1.
CB609913 mRNA. No translation available.
RefSeqiNP_001012032.1. NM_001012032.1. [Q5U2Z7-2]
UniGeneiRn.24657.

3D structure databases

ProteinModelPortaliQ5U2Z7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000002857.

PTM databases

iPTMnetiQ5U2Z7.
PhosphoSiteiQ5U2Z7.

Proteomic databases

PaxDbiQ5U2Z7.
PRIDEiQ5U2Z7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi305156.
KEGGirno:305156.

Organism-specific databases

CTDi83478.
RGDi1306669. Arhgap24.

Phylogenomic databases

eggNOGiKOG4270. Eukaryota.
ENOG410XRR2. LUCA.
HOGENOMiHOG000232151.
HOVERGENiHBG058875.
InParanoidiQ5U2Z7.
OMAiETFVGNN.
PhylomeDBiQ5U2Z7.
TreeFamiTF323577.

Enzyme and pathway databases

ReactomeiR-RNO-194840. Rho GTPase cycle.

Miscellaneous databases

PROiQ5U2Z7.

Gene expression databases

BgeeiENSRNOG00000002095.
ExpressionAtlasiQ5U2Z7. differential.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50238. RHOGAP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRHG24_RAT
AccessioniPrimary (citable) accession number: Q5U2Z7
Secondary accession number(s): Q6I7R2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 20, 2007
Last modified: September 7, 2016
This is version 101 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.