Q5TYM5 (FA72A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 64.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein FAM72A Alternative name(s): Latent membrane protein 1-induced protein Short name=LMP1-induced protein Short name=LMPIP | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 149 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in the regulation of cellular reactive oxygen species metabolism. May participate in cell growth regulation. Ref.4 |
| Subunit structure | Interacts with UNG. Ref.3 |
| Subcellular location | Cytoplasm. Mitochondrion. Note: A V5 epitope-tagged construct has been shown to localize to the nucleus (Ref.3). 5-7% of total FAM72A is associated with mitochondria around the nucleus in HEK293 cells (Ref.4). Ref.3 Ref.4 |
| Tissue specificity | May be up-regulated in malignant colon cancers, compared to normal colon and colon adenomas. Expression is also elevated in other common cancer types, including breast, lung, uterus, and ovary. Ref.3 |
| Induction | Up-regulated in peripheral blood mononuclear cells following Epstein-Barr virus (EBV) infection or following transfection with EBV LMP1 protein. Ref.4 |
| Miscellaneous | Highly homologous to GCUD2 but localized to a distinct locus. |
| Sequence similarities | Belongs to the FAM72 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Mitochondrion |
| Coding sequence diversity | Alternative splicing |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | mitochondrion Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5TYM5-1) Also known as: Ugene-p; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5TYM5-2) The sequence of this isoform differs from the canonical sequence as follows: 11-51: RCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTN → S | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Skin. |
| [3] | "Ugene, a newly identified protein that is commonly overexpressed in cancer and binds uracil DNA glycosylase." Guo C., Zhang X., Fink S.P., Platzer P., Wilson K., Willson J.K., Wang Z., Markowitz S.D. Cancer Res. 68:6118-6126(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH UNG, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF TRP-125. |
| [4] | "Functional interaction of Ugene and EBV infection mediates tumorigenic effects." Wang L.T., Lin C.S., Chai C.Y., Liu K.Y., Chen J.Y., Hsu S.H. Oncogene 30:2921-2932(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INDUCTION BY EBV INFECTION. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | CR407567 Genomic DNA. Translation: CAH72365.1. CR407567 Genomic DNA. Translation: CAH72366.1. BC035696 mRNA. Translation: AAH35696.1. BC146978 mRNA. Translation: AAI46979.1. BC146992 mRNA. Translation: AAI46993.1. |
| IPI | IPI00329150. IPI00647785. |
| RefSeq | NP_001116640.1. NM_001123168.1. |
| UniGene | Hs.661924. |
3D structure databases | |
| ProteinModelPortal | Q5TYM5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000356096. |
Polymorphism databases | |
| DMDM | 74746671. |
Proteomic databases | |
| PaxDb | Q5TYM5. |
| PRIDE | Q5TYM5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000341209; ENSP00000340661; ENSG00000196550. ENST00000367128; ENSP00000356096; ENSG00000196550. ENST00000583602; ENSP00000463023; ENSG00000263687. ENST00000584006; ENSP00000462095; ENSG00000263687. |
| GeneID | 729533. |
| KEGG | hsa:729533. |
| UCSC | uc001hdr.4. human. |
Organism-specific databases | |
| CTD | 729533. |
| GeneCards | GC01P206136. |
| HGNC | HGNC:24044. FAM72A. |
| HPA | HPA043271. |
| MIM | 614710. gene. |
| neXtProt | NX_Q5TYM5. |
| PharmGKB | PA142671833. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG42824. |
| HOGENOM | HOG000031184. |
| HOVERGEN | HBG055076. |
| OMA | CKPCLLS. |
| OrthoDB | EOG4QVCDB. |
Gene expression databases | |
| ArrayExpress | Q5TYM5. |
| Bgee | Q5TYM5. |
| Genevestigator | Q5TYM5. |
Family and domain databases | |
| InterPro | IPR026768. FAM72. [Graphical view] |
| PANTHER | PTHR31841. PTHR31841. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | FAM72A. human. |
| GenomeRNAi | 729533. |
| NextBio | 130571. |
| SOURCE | Search... |
Entry information
| Entry name | FA72A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5TYM5 Secondary accession number(s): B2RV15, Q5TYM4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
