Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM72A

Gene

FAM72A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May play a role in the regulation of cellular reactive oxygen species metabolism. May participate in cell growth regulation.1 Publication

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM72A
Alternative name(s):
Latent membrane protein 1-induced protein
Short name:
LMP1-induced protein
Short name:
LMPIP
Gene namesi
Name:FAM72A
Synonyms:UGENE
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:24044. FAM72A.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Mitochondrion

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi125 – 1251W → R: Loss of UNG-binding. 1 Publication

Organism-specific databases

PharmGKBiPA142671833.

Polymorphism and mutation databases

BioMutaiFAM72A.
DMDMi74746671.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 149149Protein FAM72APRO_0000340256Add
BLAST

Proteomic databases

PaxDbiQ5TYM5.
PRIDEiQ5TYM5.

PTM databases

iPTMnetiQ5TYM5.

Expressioni

Tissue specificityi

May be up-regulated in malignant colon cancers, compared to normal colon and colon adenomas. Expression is also elevated in other common cancer types, including breast, lung, uterus, and ovary.1 Publication

Inductioni

Up-regulated in peripheral blood mononuclear cells following Epstein-Barr virus (EBV) infection or following transfection with EBV LMP1 protein.1 Publication

Gene expression databases

BgeeiQ5TYM5.
ExpressionAtlasiQ5TYM5. baseline and differential.
GenevisibleiQ5TYM5. HS.

Organism-specific databases

HPAiHPA043271.

Interactioni

Subunit structurei

Interacts with UNG.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
MPPED2Q157773EBI-10237116,EBI-2350461

Protein-protein interaction databases

BioGridi609932. 1 interaction.
IntActiQ5TYM5. 1 interaction.
STRINGi9606.ENSP00000356096.

Structurei

3D structure databases

ProteinModelPortaliQ5TYM5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM72 family.Curated

Phylogenomic databases

eggNOGiENOG410IKHG. Eukaryota.
ENOG4111KE6. LUCA.
GeneTreeiENSGT00390000005106.
HOGENOMiHOG000031184.
HOVERGENiHBG055076.
InParanoidiQ5TYM5.
OMAiSCSFKDR.
PhylomeDBiQ5TYM5.
TreeFamiTF329231.

Family and domain databases

InterProiIPR026768. FAM72.
[Graphical view]
PANTHERiPTHR31841. PTHR31841. 1 hit.
PfamiPF14976. FAM72. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5TYM5-1) [UniParc]FASTAAdd to basket

Also known as: Ugene-p

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSTNICSFKD RCVSILCCKF CKQVLSSRGM KAVLLADTEI DLFSTDIPPT
60 70 80 90 100
NAVDFTGRCY FTKICKCKLK DIACLKCGNI VGYHVIVPCS SCLLSCNNGH
110 120 130 140
FWMFHSQAVY DINRLDSTGV NVLLWGNLPE IEESTDEDVL NISAEECIR
Length:149
Mass (Da):16,619
Last modified:December 7, 2004 - v1
Checksum:iEB55B1921DED9EBB
GO
Isoform 2 (identifier: Q5TYM5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     11-51: RCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTN → S

Note: No experimental confirmation available.
Show »
Length:109
Mass (Da):12,207
Checksum:i0672B138D822F6FD
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei11 – 5141RCVSI…IPPTN → S in isoform 2. CuratedVSP_034205Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CR407567 Genomic DNA. Translation: CAH72365.1.
CR407567 Genomic DNA. Translation: CAH72366.1.
BC035696 mRNA. Translation: AAH35696.1.
BC146978 mRNA. Translation: AAI46979.1.
BC146992 mRNA. Translation: AAI46993.1.
CCDSiCCDS73016.1. [Q5TYM5-1]
RefSeqiNP_001116640.1. NM_001123168.2. [Q5TYM5-1]
NP_001304830.1. NM_001317901.1.
XP_011508269.1. XM_011509967.1. [Q5TYM5-2]
UniGeneiHs.339665.
Hs.661924.

Genome annotation databases

EnsembliENST00000341209; ENSP00000340661; ENSG00000196550. [Q5TYM5-2]
ENST00000367128; ENSP00000356096; ENSG00000196550. [Q5TYM5-1]
GeneIDi729533.
KEGGihsa:729533.
UCSCiuc001hdr.5. human. [Q5TYM5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CR407567 Genomic DNA. Translation: CAH72365.1.
CR407567 Genomic DNA. Translation: CAH72366.1.
BC035696 mRNA. Translation: AAH35696.1.
BC146978 mRNA. Translation: AAI46979.1.
BC146992 mRNA. Translation: AAI46993.1.
CCDSiCCDS73016.1. [Q5TYM5-1]
RefSeqiNP_001116640.1. NM_001123168.2. [Q5TYM5-1]
NP_001304830.1. NM_001317901.1.
XP_011508269.1. XM_011509967.1. [Q5TYM5-2]
UniGeneiHs.339665.
Hs.661924.

3D structure databases

ProteinModelPortaliQ5TYM5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi609932. 1 interaction.
IntActiQ5TYM5. 1 interaction.
STRINGi9606.ENSP00000356096.

PTM databases

iPTMnetiQ5TYM5.

Polymorphism and mutation databases

BioMutaiFAM72A.
DMDMi74746671.

Proteomic databases

PaxDbiQ5TYM5.
PRIDEiQ5TYM5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341209; ENSP00000340661; ENSG00000196550. [Q5TYM5-2]
ENST00000367128; ENSP00000356096; ENSG00000196550. [Q5TYM5-1]
GeneIDi729533.
KEGGihsa:729533.
UCSCiuc001hdr.5. human. [Q5TYM5-1]

Organism-specific databases

CTDi729533.
GeneCardsiFAM72A.
HGNCiHGNC:24044. FAM72A.
HPAiHPA043271.
MIMi614710. gene.
neXtProtiNX_Q5TYM5.
PharmGKBiPA142671833.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IKHG. Eukaryota.
ENOG4111KE6. LUCA.
GeneTreeiENSGT00390000005106.
HOGENOMiHOG000031184.
HOVERGENiHBG055076.
InParanoidiQ5TYM5.
OMAiSCSFKDR.
PhylomeDBiQ5TYM5.
TreeFamiTF329231.

Miscellaneous databases

ChiTaRSiFAM72A. human.
GenomeRNAii729533.
PROiQ5TYM5.
SOURCEiSearch...

Gene expression databases

BgeeiQ5TYM5.
ExpressionAtlasiQ5TYM5. baseline and differential.
GenevisibleiQ5TYM5. HS.

Family and domain databases

InterProiIPR026768. FAM72.
[Graphical view]
PANTHERiPTHR31841. PTHR31841. 1 hit.
PfamiPF14976. FAM72. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Skin.
  3. "Ugene, a newly identified protein that is commonly overexpressed in cancer and binds uracil DNA glycosylase."
    Guo C., Zhang X., Fink S.P., Platzer P., Wilson K., Willson J.K., Wang Z., Markowitz S.D.
    Cancer Res. 68:6118-6126(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH UNG, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF TRP-125.
  4. "Functional interaction of Ugene and EBV infection mediates tumorigenic effects."
    Wang L.T., Lin C.S., Chai C.Y., Liu K.Y., Chen J.Y., Hsu S.H.
    Oncogene 30:2921-2932(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INDUCTION BY EBV INFECTION.

Entry informationi

Entry nameiFA72A_HUMAN
AccessioniPrimary (citable) accession number: Q5TYM5
Secondary accession number(s): B2RV15, Q5TYM4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: December 7, 2004
Last modified: June 8, 2016
This is version 87 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Highly homologous to GCUD2 but localized to a distinct locus.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.