Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5THR3 (EFCB6_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 96. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
EF-hand calcium-binding domain-containing protein 6
Alternative name(s):
CAP-binding protein complex-interacting protein 1
DJ-1-binding protein
Short name=DJBP
Gene names
Name:EFCAB6
Synonyms:DJBP, KIAA1672
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1501 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Negatively regulates the androgen receptor by recruiting histone deacetylase complex, and protein DJ-1 antagonizes this inhibition by abrogation of this complex. Ref.1

Subunit structure

Binds PARK7. Part of a ternary complex containing PARK7, EFCAB6/DJBP and AR.

Subcellular location

Nucleus Ref.1.

Tissue specificity

Specifically expressed in the testis. Ref.1

Sequence similarities

Contains 17 EF-hand domains.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
   LigandCalcium
Metal-binding
   Molecular functionRepressor
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processregulation of transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentnucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functioncalcium ion binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q5THR3-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q5THR3-2)

Also known as: Isoform b;

The sequence of this isoform differs from the canonical sequence as follows:
     1-152: Missing.
Isoform 3 (identifier: Q5THR3-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-931: Missing.
Isoform 4 (identifier: Q5THR3-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1139: Missing.
     1140-1140: E → M
Note: No experimental confirmation available.
Isoform 6 (identifier: Q5THR3-6)

The sequence of this isoform differs from the canonical sequence as follows:
     418-420: KPD → VRF
     421-1501: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: Q5THR3-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1217-1249: FDRLWNEMPVNAKGRLKYPDFLSRFSSETAATP → VRNASQSSPCTPLAERQPGPWPECTEFKTVLYF
     1250-1501: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 15011501EF-hand calcium-binding domain-containing protein 6
PRO_0000246024

Regions

Domain70 – 10536EF-hand 1
Domain172 – 20736EF-hand 2
Domain297 – 33236EF-hand 3
Domain403 – 43836EF-hand 4
Domain439 – 47436EF-hand 5
Domain504 – 53936EF-hand 6
Domain634 – 66936EF-hand 7
Domain741 – 77636EF-hand 8
Domain847 – 88236EF-hand 9
Domain883 – 91836EF-hand 10
Domain964 – 99936EF-hand 11
Domain1069 – 110436EF-hand 12
Domain1176 – 121136EF-hand 13
Domain1212 – 124736EF-hand 14
Domain1359 – 139436EF-hand 15
Domain1434 – 146936EF-hand 16
Domain1470 – 150132EF-hand 17
Calcium binding754 – 76512 Potential
Region1303 – 1501199Interaction with PARK7
Region1407 – 150195Interaction with AR

Natural variations

Alternative sequence1 – 11391139Missing in isoform 4.
VSP_019808
Alternative sequence1 – 931931Missing in isoform 3.
VSP_019809
Alternative sequence1 – 152152Missing in isoform 2.
VSP_019810
Alternative sequence418 – 4203KPD → VRF in isoform 6.
VSP_034831
Alternative sequence421 – 15011081Missing in isoform 6.
VSP_034832
Alternative sequence11401E → M in isoform 4.
VSP_019811
Alternative sequence1217 – 124933FDRLW…TAATP → VRNASQSSPCTPLAERQPGP WPECTEFKTVLYF in isoform 5.
VSP_019812
Alternative sequence1250 – 1501252Missing in isoform 5.
VSP_019813
Natural variant1661V → A.
Corresponds to variant rs16990981 [ dbSNP | Ensembl ].
VAR_048648
Natural variant1991R → G.
Corresponds to variant rs3747203 [ dbSNP | Ensembl ].
VAR_048649
Natural variant3511T → A. Ref.2
Corresponds to variant rs5764214 [ dbSNP | Ensembl ].
VAR_048650
Natural variant3841S → A.
Corresponds to variant rs6006438 [ dbSNP | Ensembl ].
VAR_048651
Natural variant4001H → Y. Ref.2
Corresponds to variant rs137794 [ dbSNP | Ensembl ].
VAR_048652
Natural variant6801T → A. Ref.2
Corresponds to variant rs137731 [ dbSNP | Ensembl ].
VAR_048653
Natural variant7801D → N.
Corresponds to variant rs12159591 [ dbSNP | Ensembl ].
VAR_048654
Natural variant8001R → W.
Corresponds to variant rs6006514 [ dbSNP | Ensembl ].
VAR_048655
Natural variant10591A → V. Ref.1 Ref.2 Ref.5
Corresponds to variant rs9614382 [ dbSNP | Ensembl ].
VAR_048656

Experimental info

Sequence conflict4781S → P in BAF85187. Ref.2
Sequence conflict7261I → V in BAF85187. Ref.2
Sequence conflict8331A → V in BAF85187. Ref.2
Sequence conflict8821P → S in BAF85100. Ref.2
Sequence conflict9901Q → H in BAB71780. Ref.1
Sequence conflict9901Q → H in BAB15703. Ref.2
Sequence conflict10821D → G in AAH39315. Ref.5
Sequence conflict11391E → G in BAF85100. Ref.2
Sequence conflict11821T → P in BAF85187. Ref.2
Sequence conflict12181D → G in AAH39315. Ref.5

Secondary structure

........... 1501
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 21, 2004. Version 1.
Checksum: 1D380F63D7FA8FF9

FASTA1,501172,930
        10         20         30         40         50         60 
MCKMAIIPDW LRSHPHTRKF THSRPHSSPC RVYSRNGSPN KFRSSSTTAV ANPTLSSLDV 

        70         80         90        100        110        120 
KRILFQKITD RGDELQKAFQ LLDTGQNLTV SKSELRRIIT DFLMPLTREQ FQDVLAQIPL 

       130        140        150        160        170        180 
STSGTVPYLA FLSRFGGIDL YINGIKRGGG NEMNCCRTLR ELEIQVGEKV FKNIKTVMKA 

       190        200        210        220        230        240 
FELIDVNKTG LVRPQELRRV LETFCMKLRD EEYEKFSKHY NIHKDTAVDY NVFLKNLSIN 

       250        260        270        280        290        300 
NDLNLRYCMG NQEVSLENQQ AKNSKKERLL GSASSEDIWR NYSLDEIERN FCLQLSKSYE 

       310        320        330        340        350        360 
KVEKALSAGD PCKGGYVSFN YLKIVLDTFV YQIPRRIFIQ LMKRFGLKAT TKINWKQFLT 

       370        380        390        400        410        420 
SFHEPQGLQV SSKGPLTKRN SINSRNESHK ENIITKLFRH TEDHSASLKK ALLIINTKPD 

       430        440        450        460        470        480 
GPITREEFRY ILNCMAVKLS DSEFKELMQM LDPGDTGVVN TSMFIDLIEE NCRMRKTSPC 

       490        500        510        520        530        540 
TDAKTPFLLA WDSVEEIVHD TITRNLQAFY NMLRSYDLGD TGRIGRNNFK KIMHVFCPFL 

       550        560        570        580        590        600 
TNAHFIKLCS KIQDIGSGRI LYKKLLACIG IDGPPTVSPV LVPKDQLLSE HLQKDEQQQP 

       610        620        630        640        650        660 
DLSERTKLTE DKTTLTKKMT TEEVIEKFKK CIQQQDPAFK KRFLDFSKEP NGKINVHDFK 

       670        680        690        700        710        720 
KVLEDTGMPM DDDQYALLTT KIGFEKEGMS YLDFAAGFED PPMRGPETTP PQPPTPSKSY 

       730        740        750        760        770        780 
VNSHFITAEE CLKLFPRRLK ESFRDPYSAF FKTDADRDGI INMHDLHRLL LHLLLNLKDD 

       790        800        810        820        830        840 
EFERFLGLLG LRLSVTLNFR EFQNLCEKRP WRTDEAPQRL IRPKQKVADS ELACEQAHQY 

       850        860        870        880        890        900 
LVTKAKNRWS DLSKNFLETD NEGNGILRRR DIKNALYGFD IPLTPREFEK LWARYDTEGK 

       910        920        930        940        950        960 
GHITYQEFLQ KLGINYSPAV HRPCAEDYFN FMGHFTKPQQ LQEEMKELQQ STEKAVAARD 

       970        980        990       1000       1010       1020 
KLMDRHQDIS KAFTKTDQSK TNYISICKMQ EVLEECGCSL TEGELTHLLN SWGVSRHDNA 

      1030       1040       1050       1060       1070       1080 
INYLDFLRAV ENSKSTGAQP KEKEESMPIN FATLNPQEAV RKIQEVVESS QLALSTAFSA 

      1090       1100       1110       1120       1130       1140 
LDKEDTGFVK ATEFGQVLKD FCYKLTDNQY HYFLRKLRIH LTPYINWKYF LQNFSCFLEE 

      1150       1160       1170       1180       1190       1200 
TADEWAEKMP KGPPPTSPKA TADRDILARL HKAVTSHYHA ITQEFENFDT MKTNTISREE 

      1210       1220       1230       1240       1250       1260 
FRAICNRRVQ ILTDEQFDRL WNEMPVNAKG RLKYPDFLSR FSSETAATPM ATGDSAVAQR 

      1270       1280       1290       1300       1310       1320 
GSSVPDVSEG TRSALSLPTQ ELRPGSKSQS HPCTPASTTV IPGTPPLQNC DPIESRLRKR 

      1330       1340       1350       1360       1370       1380 
IQGCWRQLLK ECKEKDVARQ GDINASDFLA LVEKFNLDIS KEECQQLIIK YDLKSNGKFA 

      1390       1400       1410       1420       1430       1440 
YCDFIQSCVL LLKAKESSLM HRMKIQNAHK MKEAGAETPS FYSALLRIQP KIVHCWRPMR 

      1450       1460       1470       1480       1490       1500 
RTFKSYDEAG TGLLSVADFR TVLRQYSINL SEEEFFHILE YYDKTLSSKI SYNDFLRAFL 


Q 

« Hide

Isoform 2 (Isoform b) [UniParc].

Checksum: F87F0B8368C7E476
Show »

FASTA1,349155,839
Isoform 3 [UniParc].

Checksum: F3FB697CB1D3161E
Show »

FASTA57065,308
Isoform 4 [UniParc].

Checksum: 46B36F8248128C3F
Show »

FASTA36241,263
Isoform 6 [UniParc].

Checksum: CC793F6A57192EA9
Show »

FASTA42048,464
Isoform 5 [UniParc].

Checksum: D35F8F03F7772E08
Show »

FASTA1,249144,276

References

« Hide 'large scale' references
[1]"DJBP: a novel DJ-1-binding protein, negatively regulates the androgen receptor by recruiting histone deacetylase complex, and DJ-1 antagonizes this inhibition by abrogation of this complex."
Niki T., Takahashi-Niki K., Taira T., Iguchi-Ariga S.M.M., Ariga H.
Mol. Cancer Res. 1:247-261(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH PARK7 AND AR, VARIANT VAL-1059.
Tissue: Testis.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANTS ALA-351; TYR-400; ALA-680 AND VAL-1059.
Tissue: Lung and Testis.
[3]"Reevaluating human gene annotation: a second-generation analysis of chromosome 22."
Collins J.E., Goward M.E., Cole C.G., Smink L.J., Huckle E.J., Knowles S., Bye J.M., Beare D.M., Dunham I.
Genome Res. 13:27-36(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
[4]"The DNA sequence of human chromosome 22."
Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. expand/collapse author list , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT VAL-1059.
Tissue: Testis.
[6]"Identification of novel transcribed sequences on human chromosome 22 by expressed sequence tag mapping."
Hirosawa M., Nagase T., Murahashi Y., Kikuno R., Ohara O.
DNA Res. 8:1-9(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 855-1501 (ISOFORM 5).
Tissue: Brain.
[7]"Crystal structure of DJBP fragment which was obtained by limited proteolysis."
Honbou K., Suzuki N.N., Horiuchi M., Taira T., Niki T., Ariga H., Inagaki F.
Submitted (AUG-2005) to the PDB data bank
Cited for: X-RAY CRYSTALLOGRAPHY (1.6 ANGSTROMS) OF 1160-1260.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB073862 mRNA. Translation: BAB71780.1.
AK027241 mRNA. Translation: BAB15703.1.
AK292411 mRNA. Translation: BAF85100.1.
AK292498 mRNA. Translation: BAF85187.1.
AL355841 mRNA. Translation: CAB91065.1.
Z82201 expand/collapse EMBL AC list , AL023801, AL031843, AL118498, Z97055 Genomic DNA. Translation: CAQ07046.1.
Z82201, AL023801, Z97055 Genomic DNA. Translation: CAQ07047.1.
Z97055 expand/collapse EMBL AC list , AL023801, AL031843, AL118498, Z82201 Genomic DNA. Translation: CAQ09926.1.
Z97055, AL023801, Z82201 Genomic DNA. Translation: CAQ09928.1.
AL023801 expand/collapse EMBL AC list , AL031843, AL118498, Z82201, Z97055 Genomic DNA. Translation: CAQ10020.1.
AL023801, Z82201, Z97055 Genomic DNA. Translation: CAQ10022.1.
AL031843 expand/collapse EMBL AC list , AL023801, AL118498, Z82201, Z97055 Genomic DNA. Translation: CAQ10334.1.
AL118498 expand/collapse EMBL AC list , AL023801, AL031843, Z82201, Z97055 Genomic DNA. Translation: CAQ11050.1.
BC039315 mRNA. Translation: AAH39315.1.
AB051459 mRNA. Translation: BAB33342.1.
CCDSCCDS14049.1. [Q5THR3-1]
CCDS14050.1. [Q5THR3-2]
RefSeqNP_073622.2. NM_022785.3. [Q5THR3-1]
NP_942153.1. NM_198856.2. [Q5THR3-2]
UniGeneHs.658996.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1WLZX-ray1.60A/B/C/D1160-1260[»]
ProteinModelPortalQ5THR3.
SMRQ5THR3. Positions 74-235, 304-361, 410-466, 777-803, 851-910, 971-1030, 1077-1131, 1160-1242, 1358-1384, 1440-1498.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122306. 4 interactions.

PTM databases

PhosphoSiteQ5THR3.

Polymorphism databases

DMDM74756634.

Proteomic databases

PaxDbQ5THR3.
PRIDEQ5THR3.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000262726; ENSP00000262726; ENSG00000186976. [Q5THR3-1]
ENST00000396231; ENSP00000379533; ENSG00000186976. [Q5THR3-2]
GeneID64800.
KEGGhsa:64800.
UCSCuc003bdy.2. human. [Q5THR3-1]
uc003bea.2. human. [Q5THR3-6]
uc010gzj.1. human. [Q5THR3-3]
uc031rxz.1. human. [Q5THR3-4]

Organism-specific databases

CTD64800.
GeneCardsGC22M043924.
H-InvDBHIX0016558.
HGNCHGNC:24204. EFCAB6.
HPAHPA003098.
HPA018946.
neXtProtNX_Q5THR3.
PharmGKBPA162384324.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG46752.
HOVERGENHBG095997.
InParanoidQ5THR3.
OMAGMPMDDD.
OrthoDBEOG7SV0TX.
PhylomeDBQ5THR3.
TreeFamTF329179.

Gene expression databases

ArrayExpressQ5THR3.
BgeeQ5THR3.
CleanExHS_EFCAB6.
GenevestigatorQ5THR3.

Family and domain databases

Gene3D1.10.238.10. 11 hits.
InterProIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR015070. EF_hand_Ca-bd_contain_6.
IPR002048. EF_hand_dom.
[Graphical view]
PfamPF08976. DUF1880. 1 hit.
PF13499. EF-hand_7. 1 hit.
[Graphical view]
SMARTSM00054. EFh. 12 hits.
[Graphical view]
PROSITEPS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 17 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSEFCAB6. human.
EvolutionaryTraceQ5THR3.
GeneWikiEFCAB6.
GenomeRNAi64800.
NextBio66882.
PROQ5THR3.

Entry information

Entry nameEFCB6_HUMAN
AccessionPrimary (citable) accession number: Q5THR3
Secondary accession number(s): A8K8P6 expand/collapse secondary AC list , A8K8Y3, B0QYI4, B0QYI6, Q5U5T6, Q9BY88, Q9H5C4, Q9NSF5
Entry history
Integrated into UniProtKB/Swiss-Prot: July 11, 2006
Last sequence update: December 21, 2004
Last modified: July 9, 2014
This is version 96 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 22

Human chromosome 22: entries, gene names and cross-references to MIM