SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5THR3

- EFCB6_HUMAN

UniProt

Q5THR3 - EFCB6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
EF-hand calcium-binding domain-containing protein 6
Gene
EFCAB6, DJBP, KIAA1672
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Negatively regulates the androgen receptor by recruiting histone deacetylase complex, and protein DJ-1 antagonizes this inhibition by abrogation of this complex.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi754 – 76512 Reviewed prediction
Add
BLAST

GO - Molecular functioni

  1. calcium ion binding Source: InterPro

GO - Biological processi

  1. regulation of transcription, DNA-templated Source: UniProtKB-KW
  2. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

Calcium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
EF-hand calcium-binding domain-containing protein 6
Alternative name(s):
CAP-binding protein complex-interacting protein 1
DJ-1-binding protein
Short name:
DJBP
Gene namesi
Name:EFCAB6
Synonyms:DJBP, KIAA1672
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 22

Organism-specific databases

HGNCiHGNC:24204. EFCAB6.

Subcellular locationi

Nucleus 1 Publication

GO - Cellular componenti

  1. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162384324.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 15011501EF-hand calcium-binding domain-containing protein 6
PRO_0000246024Add
BLAST

Proteomic databases

PaxDbiQ5THR3.
PRIDEiQ5THR3.

PTM databases

PhosphoSiteiQ5THR3.

Expressioni

Tissue specificityi

Specifically expressed in the testis.1 Publication

Gene expression databases

ArrayExpressiQ5THR3.
BgeeiQ5THR3.
CleanExiHS_EFCAB6.
GenevestigatoriQ5THR3.

Organism-specific databases

HPAiHPA003098.
HPA018946.

Interactioni

Subunit structurei

Binds PARK7. Part of a ternary complex containing PARK7, EFCAB6/DJBP and AR.

Protein-protein interaction databases

BioGridi122306. 4 interactions.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi1164 – 117613
Helixi1178 – 118811
Helixi1198 – 120811
Helixi1214 – 12218
Helixi1234 – 12418

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1WLZX-ray1.60A/B/C/D1160-1260[»]
ProteinModelPortaliQ5THR3.
SMRiQ5THR3. Positions 74-235, 304-361, 410-466, 777-803, 851-910, 971-1030, 1077-1131, 1160-1242, 1358-1384, 1440-1498.

Miscellaneous databases

EvolutionaryTraceiQ5THR3.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini70 – 10536EF-hand 1
Add
BLAST
Domaini172 – 20736EF-hand 2
Add
BLAST
Domaini297 – 33236EF-hand 3
Add
BLAST
Domaini403 – 43836EF-hand 4
Add
BLAST
Domaini439 – 47436EF-hand 5
Add
BLAST
Domaini504 – 53936EF-hand 6
Add
BLAST
Domaini634 – 66936EF-hand 7
Add
BLAST
Domaini741 – 77636EF-hand 8
Add
BLAST
Domaini847 – 88236EF-hand 9
Add
BLAST
Domaini883 – 91836EF-hand 10
Add
BLAST
Domaini964 – 99936EF-hand 11
Add
BLAST
Domaini1069 – 110436EF-hand 12
Add
BLAST
Domaini1176 – 121136EF-hand 13
Add
BLAST
Domaini1212 – 124736EF-hand 14
Add
BLAST
Domaini1359 – 139436EF-hand 15
Add
BLAST
Domaini1434 – 146936EF-hand 16
Add
BLAST
Domaini1470 – 150132EF-hand 17
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1303 – 1501199Interaction with PARK7
Add
BLAST
Regioni1407 – 150195Interaction with AR
Add
BLAST

Sequence similaritiesi

Contains 17 EF-hand domains.

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG46752.
HOVERGENiHBG095997.
InParanoidiQ5THR3.
OMAiGMPMDDD.
OrthoDBiEOG7SV0TX.
PhylomeDBiQ5THR3.
TreeFamiTF329179.

Family and domain databases

Gene3Di1.10.238.10. 11 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR015070. EF_hand_Ca-bd_contain_6.
IPR002048. EF_hand_dom.
[Graphical view]
PfamiPF08976. DUF1880. 1 hit.
PF13499. EF-hand_7. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 12 hits.
[Graphical view]
PROSITEiPS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 17 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5THR3-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MCKMAIIPDW LRSHPHTRKF THSRPHSSPC RVYSRNGSPN KFRSSSTTAV     50
ANPTLSSLDV KRILFQKITD RGDELQKAFQ LLDTGQNLTV SKSELRRIIT 100
DFLMPLTREQ FQDVLAQIPL STSGTVPYLA FLSRFGGIDL YINGIKRGGG 150
NEMNCCRTLR ELEIQVGEKV FKNIKTVMKA FELIDVNKTG LVRPQELRRV 200
LETFCMKLRD EEYEKFSKHY NIHKDTAVDY NVFLKNLSIN NDLNLRYCMG 250
NQEVSLENQQ AKNSKKERLL GSASSEDIWR NYSLDEIERN FCLQLSKSYE 300
KVEKALSAGD PCKGGYVSFN YLKIVLDTFV YQIPRRIFIQ LMKRFGLKAT 350
TKINWKQFLT SFHEPQGLQV SSKGPLTKRN SINSRNESHK ENIITKLFRH 400
TEDHSASLKK ALLIINTKPD GPITREEFRY ILNCMAVKLS DSEFKELMQM 450
LDPGDTGVVN TSMFIDLIEE NCRMRKTSPC TDAKTPFLLA WDSVEEIVHD 500
TITRNLQAFY NMLRSYDLGD TGRIGRNNFK KIMHVFCPFL TNAHFIKLCS 550
KIQDIGSGRI LYKKLLACIG IDGPPTVSPV LVPKDQLLSE HLQKDEQQQP 600
DLSERTKLTE DKTTLTKKMT TEEVIEKFKK CIQQQDPAFK KRFLDFSKEP 650
NGKINVHDFK KVLEDTGMPM DDDQYALLTT KIGFEKEGMS YLDFAAGFED 700
PPMRGPETTP PQPPTPSKSY VNSHFITAEE CLKLFPRRLK ESFRDPYSAF 750
FKTDADRDGI INMHDLHRLL LHLLLNLKDD EFERFLGLLG LRLSVTLNFR 800
EFQNLCEKRP WRTDEAPQRL IRPKQKVADS ELACEQAHQY LVTKAKNRWS 850
DLSKNFLETD NEGNGILRRR DIKNALYGFD IPLTPREFEK LWARYDTEGK 900
GHITYQEFLQ KLGINYSPAV HRPCAEDYFN FMGHFTKPQQ LQEEMKELQQ 950
STEKAVAARD KLMDRHQDIS KAFTKTDQSK TNYISICKMQ EVLEECGCSL 1000
TEGELTHLLN SWGVSRHDNA INYLDFLRAV ENSKSTGAQP KEKEESMPIN 1050
FATLNPQEAV RKIQEVVESS QLALSTAFSA LDKEDTGFVK ATEFGQVLKD 1100
FCYKLTDNQY HYFLRKLRIH LTPYINWKYF LQNFSCFLEE TADEWAEKMP 1150
KGPPPTSPKA TADRDILARL HKAVTSHYHA ITQEFENFDT MKTNTISREE 1200
FRAICNRRVQ ILTDEQFDRL WNEMPVNAKG RLKYPDFLSR FSSETAATPM 1250
ATGDSAVAQR GSSVPDVSEG TRSALSLPTQ ELRPGSKSQS HPCTPASTTV 1300
IPGTPPLQNC DPIESRLRKR IQGCWRQLLK ECKEKDVARQ GDINASDFLA 1350
LVEKFNLDIS KEECQQLIIK YDLKSNGKFA YCDFIQSCVL LLKAKESSLM 1400
HRMKIQNAHK MKEAGAETPS FYSALLRIQP KIVHCWRPMR RTFKSYDEAG 1450
TGLLSVADFR TVLRQYSINL SEEEFFHILE YYDKTLSSKI SYNDFLRAFL 1500
Q 1501
Length:1,501
Mass (Da):172,930
Last modified:December 21, 2004 - v1
Checksum:i1D380F63D7FA8FF9
GO
Isoform 2 (identifier: Q5THR3-2) [UniParc]FASTAAdd to Basket

Also known as: Isoform b

The sequence of this isoform differs from the canonical sequence as follows:
     1-152: Missing.

Show »
Length:1,349
Mass (Da):155,839
Checksum:iF87F0B8368C7E476
GO
Isoform 3 (identifier: Q5THR3-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-931: Missing.

Show »
Length:570
Mass (Da):65,308
Checksum:iF3FB697CB1D3161E
GO
Isoform 4 (identifier: Q5THR3-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1139: Missing.
     1140-1140: E → M

Note: No experimental confirmation available.

Show »
Length:362
Mass (Da):41,263
Checksum:i46B36F8248128C3F
GO
Isoform 6 (identifier: Q5THR3-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     418-420: KPD → VRF
     421-1501: Missing.

Note: No experimental confirmation available.

Show »
Length:420
Mass (Da):48,464
Checksum:iCC793F6A57192EA9
GO
Isoform 5 (identifier: Q5THR3-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1217-1249: FDRLWNEMPVNAKGRLKYPDFLSRFSSETAATP → VRNASQSSPCTPLAERQPGPWPECTEFKTVLYF
     1250-1501: Missing.

Note: No experimental confirmation available.

Show »
Length:1,249
Mass (Da):144,276
Checksum:iD35F8F03F7772E08
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti166 – 1661V → A.
Corresponds to variant rs16990981 [ dbSNP | Ensembl ].
VAR_048648
Natural varianti199 – 1991R → G.
Corresponds to variant rs3747203 [ dbSNP | Ensembl ].
VAR_048649
Natural varianti351 – 3511T → A.1 Publication
Corresponds to variant rs5764214 [ dbSNP | Ensembl ].
VAR_048650
Natural varianti384 – 3841S → A.
Corresponds to variant rs6006438 [ dbSNP | Ensembl ].
VAR_048651
Natural varianti400 – 4001H → Y.1 Publication
Corresponds to variant rs137794 [ dbSNP | Ensembl ].
VAR_048652
Natural varianti680 – 6801T → A.1 Publication
Corresponds to variant rs137731 [ dbSNP | Ensembl ].
VAR_048653
Natural varianti780 – 7801D → N.
Corresponds to variant rs12159591 [ dbSNP | Ensembl ].
VAR_048654
Natural varianti800 – 8001R → W.
Corresponds to variant rs6006514 [ dbSNP | Ensembl ].
VAR_048655
Natural varianti1059 – 10591A → V.3 Publications
Corresponds to variant rs9614382 [ dbSNP | Ensembl ].
VAR_048656

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11391139Missing in isoform 4.
VSP_019808Add
BLAST
Alternative sequencei1 – 931931Missing in isoform 3.
VSP_019809Add
BLAST
Alternative sequencei1 – 152152Missing in isoform 2.
VSP_019810Add
BLAST
Alternative sequencei418 – 4203KPD → VRF in isoform 6.
VSP_034831
Alternative sequencei421 – 15011081Missing in isoform 6.
VSP_034832Add
BLAST
Alternative sequencei1140 – 11401E → M in isoform 4.
VSP_019811
Alternative sequencei1217 – 124933FDRLW…TAATP → VRNASQSSPCTPLAERQPGP WPECTEFKTVLYF in isoform 5.
VSP_019812Add
BLAST
Alternative sequencei1250 – 1501252Missing in isoform 5.
VSP_019813Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti478 – 4781S → P in BAF85187. 1 Publication
Sequence conflicti726 – 7261I → V in BAF85187. 1 Publication
Sequence conflicti833 – 8331A → V in BAF85187. 1 Publication
Sequence conflicti882 – 8821P → S in BAF85100. 1 Publication
Sequence conflicti990 – 9901Q → H in BAB71780. 1 Publication
Sequence conflicti990 – 9901Q → H in BAB15703. 1 Publication
Sequence conflicti1082 – 10821D → G in AAH39315. 1 Publication
Sequence conflicti1139 – 11391E → G in BAF85100. 1 Publication
Sequence conflicti1182 – 11821T → P in BAF85187. 1 Publication
Sequence conflicti1218 – 12181D → G in AAH39315. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB073862 mRNA. Translation: BAB71780.1.
AK027241 mRNA. Translation: BAB15703.1.
AK292411 mRNA. Translation: BAF85100.1.
AK292498 mRNA. Translation: BAF85187.1.
AL355841 mRNA. Translation: CAB91065.1.
Z82201
, AL023801, AL031843, AL118498, Z97055 Genomic DNA. Translation: CAQ07046.1.
Z82201, AL023801, Z97055 Genomic DNA. Translation: CAQ07047.1.
Z97055
, AL023801, AL031843, AL118498, Z82201 Genomic DNA. Translation: CAQ09926.1.
Z97055, AL023801, Z82201 Genomic DNA. Translation: CAQ09928.1.
AL023801
, AL031843, AL118498, Z82201, Z97055 Genomic DNA. Translation: CAQ10020.1.
AL023801, Z82201, Z97055 Genomic DNA. Translation: CAQ10022.1.
AL031843
, AL023801, AL118498, Z82201, Z97055 Genomic DNA. Translation: CAQ10334.1.
AL118498
, AL023801, AL031843, Z82201, Z97055 Genomic DNA. Translation: CAQ11050.1.
BC039315 mRNA. Translation: AAH39315.1.
AB051459 mRNA. Translation: BAB33342.1.
CCDSiCCDS14049.1. [Q5THR3-1]
CCDS14050.1. [Q5THR3-2]
RefSeqiNP_073622.2. NM_022785.3. [Q5THR3-1]
NP_942153.1. NM_198856.2. [Q5THR3-2]
UniGeneiHs.658996.

Genome annotation databases

EnsembliENST00000262726; ENSP00000262726; ENSG00000186976. [Q5THR3-1]
ENST00000396231; ENSP00000379533; ENSG00000186976. [Q5THR3-2]
GeneIDi64800.
KEGGihsa:64800.
UCSCiuc003bdy.2. human. [Q5THR3-1]
uc003bea.2. human. [Q5THR3-6]
uc010gzj.1. human. [Q5THR3-3]
uc031rxz.1. human. [Q5THR3-4]

Polymorphism databases

DMDMi74756634.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB073862 mRNA. Translation: BAB71780.1 .
AK027241 mRNA. Translation: BAB15703.1 .
AK292411 mRNA. Translation: BAF85100.1 .
AK292498 mRNA. Translation: BAF85187.1 .
AL355841 mRNA. Translation: CAB91065.1 .
Z82201
, AL023801 , AL031843 , AL118498 , Z97055 Genomic DNA. Translation: CAQ07046.1 .
Z82201 , AL023801 , Z97055 Genomic DNA. Translation: CAQ07047.1 .
Z97055
, AL023801 , AL031843 , AL118498 , Z82201 Genomic DNA. Translation: CAQ09926.1 .
Z97055 , AL023801 , Z82201 Genomic DNA. Translation: CAQ09928.1 .
AL023801
, AL031843 , AL118498 , Z82201 , Z97055 Genomic DNA. Translation: CAQ10020.1 .
AL023801 , Z82201 , Z97055 Genomic DNA. Translation: CAQ10022.1 .
AL031843
, AL023801 , AL118498 , Z82201 , Z97055 Genomic DNA. Translation: CAQ10334.1 .
AL118498
, AL023801 , AL031843 , Z82201 , Z97055 Genomic DNA. Translation: CAQ11050.1 .
BC039315 mRNA. Translation: AAH39315.1 .
AB051459 mRNA. Translation: BAB33342.1 .
CCDSi CCDS14049.1. [Q5THR3-1 ]
CCDS14050.1. [Q5THR3-2 ]
RefSeqi NP_073622.2. NM_022785.3. [Q5THR3-1 ]
NP_942153.1. NM_198856.2. [Q5THR3-2 ]
UniGenei Hs.658996.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1WLZ X-ray 1.60 A/B/C/D 1160-1260 [» ]
ProteinModelPortali Q5THR3.
SMRi Q5THR3. Positions 74-235, 304-361, 410-466, 777-803, 851-910, 971-1030, 1077-1131, 1160-1242, 1358-1384, 1440-1498.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122306. 4 interactions.

PTM databases

PhosphoSitei Q5THR3.

Polymorphism databases

DMDMi 74756634.

Proteomic databases

PaxDbi Q5THR3.
PRIDEi Q5THR3.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000262726 ; ENSP00000262726 ; ENSG00000186976 . [Q5THR3-1 ]
ENST00000396231 ; ENSP00000379533 ; ENSG00000186976 . [Q5THR3-2 ]
GeneIDi 64800.
KEGGi hsa:64800.
UCSCi uc003bdy.2. human. [Q5THR3-1 ]
uc003bea.2. human. [Q5THR3-6 ]
uc010gzj.1. human. [Q5THR3-3 ]
uc031rxz.1. human. [Q5THR3-4 ]

Organism-specific databases

CTDi 64800.
GeneCardsi GC22M043924.
H-InvDB HIX0016558.
HGNCi HGNC:24204. EFCAB6.
HPAi HPA003098.
HPA018946.
neXtProti NX_Q5THR3.
PharmGKBi PA162384324.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG46752.
HOVERGENi HBG095997.
InParanoidi Q5THR3.
OMAi GMPMDDD.
OrthoDBi EOG7SV0TX.
PhylomeDBi Q5THR3.
TreeFami TF329179.

Miscellaneous databases

ChiTaRSi EFCAB6. human.
EvolutionaryTracei Q5THR3.
GeneWikii EFCAB6.
GenomeRNAii 64800.
NextBioi 66882.
PROi Q5THR3.

Gene expression databases

ArrayExpressi Q5THR3.
Bgeei Q5THR3.
CleanExi HS_EFCAB6.
Genevestigatori Q5THR3.

Family and domain databases

Gene3Di 1.10.238.10. 11 hits.
InterProi IPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR015070. EF_hand_Ca-bd_contain_6.
IPR002048. EF_hand_dom.
[Graphical view ]
Pfami PF08976. DUF1880. 1 hit.
PF13499. EF-hand_7. 1 hit.
[Graphical view ]
SMARTi SM00054. EFh. 12 hits.
[Graphical view ]
PROSITEi PS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 17 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "DJBP: a novel DJ-1-binding protein, negatively regulates the androgen receptor by recruiting histone deacetylase complex, and DJ-1 antagonizes this inhibition by abrogation of this complex."
    Niki T., Takahashi-Niki K., Taira T., Iguchi-Ariga S.M.M., Ariga H.
    Mol. Cancer Res. 1:247-261(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH PARK7 AND AR, VARIANT VAL-1059.
    Tissue: Testis.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANTS ALA-351; TYR-400; ALA-680 AND VAL-1059.
    Tissue: Lung and Testis.
  3. "Reevaluating human gene annotation: a second-generation analysis of chromosome 22."
    Collins J.E., Goward M.E., Cole C.G., Smink L.J., Huckle E.J., Knowles S., Bye J.M., Beare D.M., Dunham I.
    Genome Res. 13:27-36(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
  4. "The DNA sequence of human chromosome 22."
    Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
    , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
    Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT VAL-1059.
    Tissue: Testis.
  6. "Identification of novel transcribed sequences on human chromosome 22 by expressed sequence tag mapping."
    Hirosawa M., Nagase T., Murahashi Y., Kikuno R., Ohara O.
    DNA Res. 8:1-9(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 855-1501 (ISOFORM 5).
    Tissue: Brain.
  7. "Crystal structure of DJBP fragment which was obtained by limited proteolysis."
    Honbou K., Suzuki N.N., Horiuchi M., Taira T., Niki T., Ariga H., Inagaki F.
    Submitted (AUG-2005) to the PDB data bank
    Cited for: X-RAY CRYSTALLOGRAPHY (1.6 ANGSTROMS) OF 1160-1260.

Entry informationi

Entry nameiEFCB6_HUMAN
AccessioniPrimary (citable) accession number: Q5THR3
Secondary accession number(s): A8K8P6
, A8K8Y3, B0QYI4, B0QYI6, Q5U5T6, Q9BY88, Q9H5C4, Q9NSF5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 11, 2006
Last sequence update: December 21, 2004
Last modified: July 9, 2014
This is version 96 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi