Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

5'-nucleotidase domain-containing protein 1

Gene

NT5DC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei16NucleophileBy similarity1
Metal bindingi16MagnesiumBy similarity1
Active sitei18Proton donorBy similarity1
Metal bindingi18Magnesium; via carbonyl oxygenBy similarity1
Metal bindingi313MagnesiumBy similarity1

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

Magnesium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
5'-nucleotidase domain-containing protein 1 (EC:3.1.3.-)
Gene namesi
Name:NT5DC1
Synonyms:NT5C2L1
ORF Names:LP2642
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:21556. NT5DC1.

Pathology & Biotechi

Organism-specific databases

DisGeNETi221294.
OpenTargetsiENSG00000178425.
PharmGKBiPA134892962.

Polymorphism and mutation databases

BioMutaiNT5DC1.
DMDMi74746390.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002472221 – 4555'-nucleotidase domain-containing protein 1Add BLAST455

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei171N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ5TFE4.
MaxQBiQ5TFE4.
PaxDbiQ5TFE4.
PeptideAtlasiQ5TFE4.
PRIDEiQ5TFE4.

PTM databases

DEPODiQ5TFE4.
iPTMnetiQ5TFE4.
PhosphoSitePlusiQ5TFE4.

Expressioni

Gene expression databases

BgeeiENSG00000178425.
CleanExiHS_NT5DC1.
ExpressionAtlasiQ5TFE4. baseline and differential.
GenevisibleiQ5TFE4. HS.

Organism-specific databases

HPAiHPA030352.

Interactioni

Protein-protein interaction databases

BioGridi128704. 8 interactors.
IntActiQ5TFE4. 1 interactor.
STRINGi9606.ENSP00000326858.

Structurei

3D structure databases

ProteinModelPortaliQ5TFE4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG2469. Eukaryota.
ENOG410XQAV. LUCA.
GeneTreeiENSGT00550000074539.
HOGENOMiHOG000054218.
HOVERGENiHBG058689.
OMAiYFDMPSA.
OrthoDBiEOG091G06EN.
PhylomeDBiQ5TFE4.
TreeFamiTF325912.

Family and domain databases

Gene3Di3.40.50.1000. 3 hits.
InterProiIPR023214. HAD-like_dom.
IPR008380. HAD-SF_hydro_IG_5-nucl.
[Graphical view]
PANTHERiPTHR12103. PTHR12103. 1 hit.
PfamiPF05761. 5_nucleotid. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5TFE4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQHFSLAAC DVVGFDLDHT LCRYNLPESA PLIYNSFAQF LVKEKGYDKE
60 70 80 90 100
LLNVTPEDWD FCCKGLALDL EDGNFLKLAN NGTVLRASHG TKMMTPEVLA
110 120 130 140 150
EAYGKKEWKH FLSDTGMACR SGKYYFYDNY FDLPGALLCA RVVDYLTKLN
160 170 180 190 200
NGQKTFDFWK DIVAAIQHNY KMSAFKENCG IYFPEIKRDP GRYLHSCPES
210 220 230 240 250
VKKWLRQLKN AGKILLLITS SHSDYCRLLC EYILGNDFTD LFDIVITNAL
260 270 280 290 300
KPGFFSHLPS QRPFRTLEND EEQEALPSLD KPGWYSQGNA VHLYELLKKM
310 320 330 340 350
TGKPEPKVVY FGDSMHSDIF PARHYSNWET VLILEELRGD EGTRSQRPEE
360 370 380 390 400
SEPLEKKGKY EGPKAKPLNT SSKKWGSFFI DSVLGLENTE DSLVYTWSCK
410 420 430 440 450
RISTYSTIAI PSIEAIAELP LDYKFTRFSS SNSKTAGYYP NPPLVLSSDE

TLISK
Length:455
Mass (Da):51,845
Last modified:December 21, 2004 - v1
Checksum:i1FFE79D4FD8DA236
GO
Isoform 2 (identifier: Q5TFE4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-85: MAQHFSLAAC...LKLANNGTVL → MFLLAPVATGINSHNDRGRGIQGTINEQCASSLKI

Note: No experimental confirmation available.
Show »
Length:405
Mass (Da):46,027
Checksum:i702E38FFD0537FD8
GO

Sequence cautioni

The sequence AAP34458 differs from that shown. Reason: Frameshift at position 339.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0542361 – 85MAQHF…NGTVL → MFLLAPVATGINSHNDRGRG IQGTINEQCASSLKI in isoform 2. 1 PublicationAdd BLAST85

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK090918 mRNA. Translation: BAG52247.1.
AL050331, AL121963 Genomic DNA. Translation: CAI21537.1.
AL121963, AL050331 Genomic DNA. Translation: CAI19534.1.
CH471051 Genomic DNA. Translation: EAW48237.1.
CH471051 Genomic DNA. Translation: EAW48239.1.
BC108699 mRNA. Translation: AAI08700.1.
BC136832 mRNA. Translation: AAI36833.1.
BC136841 mRNA. Translation: AAI36842.1.
AY203935 mRNA. Translation: AAP34458.1. Frameshift.
CCDSiCCDS5104.1. [Q5TFE4-1]
RefSeqiNP_689942.2. NM_152729.2. [Q5TFE4-1]
UniGeneiHs.520341.

Genome annotation databases

EnsembliENST00000319550; ENSP00000326858; ENSG00000178425. [Q5TFE4-1]
GeneIDi221294.
KEGGihsa:221294.
UCSCiuc003pwj.4. human. [Q5TFE4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK090918 mRNA. Translation: BAG52247.1.
AL050331, AL121963 Genomic DNA. Translation: CAI21537.1.
AL121963, AL050331 Genomic DNA. Translation: CAI19534.1.
CH471051 Genomic DNA. Translation: EAW48237.1.
CH471051 Genomic DNA. Translation: EAW48239.1.
BC108699 mRNA. Translation: AAI08700.1.
BC136832 mRNA. Translation: AAI36833.1.
BC136841 mRNA. Translation: AAI36842.1.
AY203935 mRNA. Translation: AAP34458.1. Frameshift.
CCDSiCCDS5104.1. [Q5TFE4-1]
RefSeqiNP_689942.2. NM_152729.2. [Q5TFE4-1]
UniGeneiHs.520341.

3D structure databases

ProteinModelPortaliQ5TFE4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128704. 8 interactors.
IntActiQ5TFE4. 1 interactor.
STRINGi9606.ENSP00000326858.

PTM databases

DEPODiQ5TFE4.
iPTMnetiQ5TFE4.
PhosphoSitePlusiQ5TFE4.

Polymorphism and mutation databases

BioMutaiNT5DC1.
DMDMi74746390.

Proteomic databases

EPDiQ5TFE4.
MaxQBiQ5TFE4.
PaxDbiQ5TFE4.
PeptideAtlasiQ5TFE4.
PRIDEiQ5TFE4.

Protocols and materials databases

DNASUi221294.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000319550; ENSP00000326858; ENSG00000178425. [Q5TFE4-1]
GeneIDi221294.
KEGGihsa:221294.
UCSCiuc003pwj.4. human. [Q5TFE4-1]

Organism-specific databases

CTDi221294.
DisGeNETi221294.
GeneCardsiNT5DC1.
HGNCiHGNC:21556. NT5DC1.
HPAiHPA030352.
neXtProtiNX_Q5TFE4.
OpenTargetsiENSG00000178425.
PharmGKBiPA134892962.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2469. Eukaryota.
ENOG410XQAV. LUCA.
GeneTreeiENSGT00550000074539.
HOGENOMiHOG000054218.
HOVERGENiHBG058689.
OMAiYFDMPSA.
OrthoDBiEOG091G06EN.
PhylomeDBiQ5TFE4.
TreeFamiTF325912.

Miscellaneous databases

ChiTaRSiNT5DC1. human.
GenomeRNAii221294.
PROiQ5TFE4.

Gene expression databases

BgeeiENSG00000178425.
CleanExiHS_NT5DC1.
ExpressionAtlasiQ5TFE4. baseline and differential.
GenevisibleiQ5TFE4. HS.

Family and domain databases

Gene3Di3.40.50.1000. 3 hits.
InterProiIPR023214. HAD-like_dom.
IPR008380. HAD-SF_hydro_IG_5-nucl.
[Graphical view]
PANTHERiPTHR12103. PTHR12103. 1 hit.
PfamiPF05761. 5_nucleotid. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiNT5D1_HUMAN
AccessioniPrimary (citable) accession number: Q5TFE4
Secondary accession number(s): B2RND9, B3KR35, Q6XYD5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: December 21, 2004
Last modified: November 2, 2016
This is version 115 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.