Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

5'-nucleotidase domain-containing protein 1

Gene

NT5DC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei16NucleophileBy similarity1
Metal bindingi16MagnesiumBy similarity1
Active sitei18Proton donorBy similarity1
Metal bindingi18Magnesium; via carbonyl oxygenBy similarity1
Metal bindingi313MagnesiumBy similarity1

GO - Molecular functioni

Keywordsi

Molecular functionHydrolase
LigandMagnesium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
5'-nucleotidase domain-containing protein 1 (EC:3.1.3.-)
Gene namesi
Name:NT5DC1
Synonyms:NT5C2L1
ORF Names:LP2642
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000178425.13
HGNCiHGNC:21556 NT5DC1
neXtProtiNX_Q5TFE4

Pathology & Biotechi

Organism-specific databases

DisGeNETi221294
OpenTargetsiENSG00000178425
PharmGKBiPA134892962

Polymorphism and mutation databases

BioMutaiNT5DC1
DMDMi74746390

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002472221 – 4555'-nucleotidase domain-containing protein 1Add BLAST455

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei171N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ5TFE4
MaxQBiQ5TFE4
PaxDbiQ5TFE4
PeptideAtlasiQ5TFE4
PRIDEiQ5TFE4

PTM databases

DEPODiQ5TFE4
iPTMnetiQ5TFE4
PhosphoSitePlusiQ5TFE4

Expressioni

Gene expression databases

BgeeiENSG00000178425
CleanExiHS_NT5DC1
ExpressionAtlasiQ5TFE4 baseline and differential
GenevisibleiQ5TFE4 HS

Organism-specific databases

HPAiHPA030352

Interactioni

Protein-protein interaction databases

BioGridi128704, 8 interactors
IntActiQ5TFE4, 1 interactor
STRINGi9606.ENSP00000326858

Structurei

3D structure databases

ProteinModelPortaliQ5TFE4
SMRiQ5TFE4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG2469 Eukaryota
ENOG410XQAV LUCA
GeneTreeiENSGT00550000074539
HOGENOMiHOG000054218
HOVERGENiHBG058689
OMAiYDCIGFD
OrthoDBiEOG091G06EN
PhylomeDBiQ5TFE4
TreeFamiTF325912

Family and domain databases

Gene3Di3.40.50.1000, 1 hit
InterProiView protein in InterPro
IPR036412 HAD-like_sf
IPR008380 HAD-SF_hydro_IG_5-nucl
IPR023214 HAD_sf
PANTHERiPTHR12103 PTHR12103, 1 hit
PfamiView protein in Pfam
PF05761 5_nucleotid, 1 hit
SUPFAMiSSF56784 SSF56784, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5TFE4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQHFSLAAC DVVGFDLDHT LCRYNLPESA PLIYNSFAQF LVKEKGYDKE
60 70 80 90 100
LLNVTPEDWD FCCKGLALDL EDGNFLKLAN NGTVLRASHG TKMMTPEVLA
110 120 130 140 150
EAYGKKEWKH FLSDTGMACR SGKYYFYDNY FDLPGALLCA RVVDYLTKLN
160 170 180 190 200
NGQKTFDFWK DIVAAIQHNY KMSAFKENCG IYFPEIKRDP GRYLHSCPES
210 220 230 240 250
VKKWLRQLKN AGKILLLITS SHSDYCRLLC EYILGNDFTD LFDIVITNAL
260 270 280 290 300
KPGFFSHLPS QRPFRTLEND EEQEALPSLD KPGWYSQGNA VHLYELLKKM
310 320 330 340 350
TGKPEPKVVY FGDSMHSDIF PARHYSNWET VLILEELRGD EGTRSQRPEE
360 370 380 390 400
SEPLEKKGKY EGPKAKPLNT SSKKWGSFFI DSVLGLENTE DSLVYTWSCK
410 420 430 440 450
RISTYSTIAI PSIEAIAELP LDYKFTRFSS SNSKTAGYYP NPPLVLSSDE

TLISK
Length:455
Mass (Da):51,845
Last modified:December 21, 2004 - v1
Checksum:i1FFE79D4FD8DA236
GO
Isoform 2 (identifier: Q5TFE4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-85: MAQHFSLAAC...LKLANNGTVL → MFLLAPVATGINSHNDRGRGIQGTINEQCASSLKI

Note: No experimental confirmation available.
Show »
Length:405
Mass (Da):46,027
Checksum:i702E38FFD0537FD8
GO

Sequence cautioni

The sequence AAP34458 differs from that shown. Reason: Frameshift at position 339.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0542361 – 85MAQHF…NGTVL → MFLLAPVATGINSHNDRGRG IQGTINEQCASSLKI in isoform 2. 1 PublicationAdd BLAST85

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK090918 mRNA Translation: BAG52247.1
AL050331, AL121963 Genomic DNA Translation: CAI21537.1
AL121963, AL050331 Genomic DNA Translation: CAI19534.1
CH471051 Genomic DNA Translation: EAW48237.1
CH471051 Genomic DNA Translation: EAW48239.1
BC108699 mRNA Translation: AAI08700.1
BC136832 mRNA Translation: AAI36833.1
BC136841 mRNA Translation: AAI36842.1
AY203935 mRNA Translation: AAP34458.1 Frameshift.
CCDSiCCDS5104.1 [Q5TFE4-1]
RefSeqiNP_689942.2, NM_152729.2 [Q5TFE4-1]
UniGeneiHs.520341

Genome annotation databases

EnsembliENST00000319550; ENSP00000326858; ENSG00000178425 [Q5TFE4-1]
GeneIDi221294
KEGGihsa:221294
UCSCiuc003pwj.4 human [Q5TFE4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNT5D1_HUMAN
AccessioniPrimary (citable) accession number: Q5TFE4
Secondary accession number(s): B2RND9, B3KR35, Q6XYD5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: December 21, 2004
Last modified: March 28, 2018
This is version 122 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health