Q5TDP6 (LGSN_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 74.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Lengsin Alternative name(s): Glutamate-ammonia ligase domain-containing protein 1 Lens glutamine synthase-like | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 509 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May act as a component of the cytoskeleton or as a chaperone for the reorganization of intermediate filament proteins during terminal differentiation in the lens. Does not seem to have enzymatic activity By similarity. |
| Subunit structure | Dodecamer. Interacts with BFSP2 AND VIM By similarity. Ref.1 |
| Tissue specificity | |
| Sequence similarities | Belongs to the glutamine synthetase family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | glutamine biosynthetic process Inferred from electronic annotation. Source: InterPro |
| Molecular_function | glutamate-ammonia ligase activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5TDP6-1) Also known as: LGS_v2; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5TDP6-2) Also known as: LGS_v1; The sequence of this isoform differs from the canonical sequence as follows: 177-208: GEPLLTSPRYIAKRQLSHLQASGFSLLSAFIY → VSGMSIGRKTCSAALLELSSSRSLGKNGWQDS 209-509: Missing. | ||||||
| Isoform 3 (identifier: Q5TDP6-3) Also known as: LGS_v3; The sequence of this isoform differs from the canonical sequence as follows: 55-118: DCMRDSSQIL...FQEKVSHGVC → ERIRNQMVCH...PGGEFNPNSE 119-509: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 509 | 509 | Lengsin | PRO_0000153282 | |||||
Natural variations | |||||||||
| Alternative sequence | 55 – 118 | 64 | DCMRD…SHGVC → ERIRNQMVCHKLGNTSKPIM GPGSAESHLSYDDKDSQDET TVIKPLPPRTTTNVPGGEFN PNSE in isoform 3. | VSP_036480 | |||||
| Alternative sequence | 119 – 509 | 391 | Missing in isoform 3. | VSP_036481 | |||||
| Alternative sequence | 177 – 208 | 32 | GEPLL…SAFIY → VSGMSIGRKTCSAALLELSS SRSLGKNGWQDS in isoform 2. | VSP_036482 | |||||
| Alternative sequence | 209 – 509 | 301 | Missing in isoform 2. | VSP_036483 | |||||
| Natural variant | 26 | 1 | N → Y. Corresponds to variant rs2459568 [ dbSNP | Ensembl ]. | VAR_054552 | |||||
| Natural variant | 46 | 1 | G → E. Corresponds to variant rs35691434 [ dbSNP | Ensembl ]. | VAR_054553 | |||||
| Natural variant | 137 | 1 | N → H. Corresponds to variant rs6454127 [ dbSNP | Ensembl ]. | VAR_054554 | |||||
Experimental info | |||||||||
| Sequence conflict | 81 | 1 | A → S in ABG75902. Ref.1 | ||||||
| Sequence conflict | 472 | 1 | L → Q in AAF61255. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structural and functional properties of lengsin, a pseudo-glutamine synthetase in the transparent human lens." Grassi F., Moretto N., Rivetti C., Cellai S., Betti M., Marquez A.J., Maraini G., Ottonello S. Biochem. Biophys. Res. Commun. 350:424-429(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), SUBUNIT, TISSUE SPECIFICITY. |
| [2] | "Expressed sequence tag analysis of adult human lens for the NEIBank project: over 2000 non-redundant transcripts, novel genes and splice variants." Wistow G., Bernstein S.L., Wyatt M.K., Behal A., Touchman J.W., Bouffard G., Smith D., Peterson K. Mol. Vis. 8:171-184(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Lens. |
| [3] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | DQ682605 mRNA. Translation: ABG75902.1. DQ682606 mRNA. Translation: ABG75903.1. AF242388 mRNA. Translation: AAF61255.1. AL121949, AL590456 Genomic DNA. Translation: CAI20481.1. CH471143 Genomic DNA. Translation: EAW88493.1. BC130366 mRNA. Translation: AAI30367.1. BC130368 mRNA. Translation: AAI30369.1. |
| IPI | IPI00009831. IPI00784706. IPI00784892. |
| RefSeq | NP_001137412.1. NM_001143940.1. NP_057655.2. NM_016571.2. |
| UniGene | Hs.149585. |
3D structure databases | |
| ProteinModelPortal | Q5TDP6. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000359691. |
PTM databases | |
| PhosphoSite | Q5TDP6. |
Polymorphism databases | |
| DMDM | 67465079. |
Proteomic databases | |
| PaxDb | Q5TDP6. |
| PeptideAtlas | Q5TDP6. |
| PRIDE | Q5TDP6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000370657; ENSP00000359691; ENSG00000146166. ENST00000370658; ENSP00000359692; ENSG00000146166. ENST00000485906; ENSP00000431246; ENSG00000146166. |
| GeneID | 51557. |
| KEGG | hsa:51557. |
| UCSC | uc003peh.3. human. uc003pei.3. human. uc003pej.1. human. |
Organism-specific databases | |
| CTD | 51557. |
| GeneCards | GC06M064048. |
| HGNC | HGNC:21016. LGSN. |
| HPA | HPA030957. |
| MIM | 611470. gene. |
| neXtProt | NX_Q5TDP6. |
| PharmGKB | PA164722103. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0174. |
| HOGENOM | HOG000113321. |
| HOVERGEN | HBG051740. |
| InParanoid | Q5TDP6. |
| OMA | DQCLRQA. |
| OrthoDB | EOG4N30NJ. |
| PhylomeDB | Q5TDP6. |
Gene expression databases | |
| Bgee | Q5TDP6. |
| CleanEx | HS_LGSN. |
| Genevestigator | Q5TDP6. |
| GermOnline | ENSG00000146166. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.10.20.70. 1 hit. 3.30.590.10. 1 hit. |
| InterPro | IPR008147. Gln_synt_beta. IPR014746. Gln_synth/guanido_kin_cat_dom. IPR008146. Gln_synth_cat_dom. [Graphical view] |
| Pfam | PF00120. Gln-synt_C. 1 hit. PF03951. Gln-synt_N. 1 hit. [Graphical view] |
| SUPFAM | SSF54368. Gln_synt_beta. 1 hit. |
| PROSITE | PS00180. GLNA_1. False negative. PS00181. GLNA_ATP. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00142. L-Glutamic Acid. |
| GenomeRNAi | 51557. |
| NextBio | 55348. |
| SOURCE | Search... |
Entry information
| Entry name | LGSN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5TDP6 Secondary accession number(s): A1L421 Q9NYJ0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
