Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lengsin

Gene

LGSN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

May act as a component of the cytoskeleton or as a chaperone for the reorganization of intermediate filament proteins during terminal differentiation in the lens. Does not seem to have enzymatic activity (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Lengsin
Alternative name(s):
Glutamate-ammonia ligase domain-containing protein 1
Lens glutamine synthase-like
Gene namesi
Name:LGSN
Synonyms:GLULD1, LGS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:21016. LGSN.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi51557.
OpenTargetsiENSG00000146166.
PharmGKBiPA164722103.

Polymorphism and mutation databases

BioMutaiLGSN.
DMDMi67465079.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001532821 – 509LengsinAdd BLAST509

Proteomic databases

PaxDbiQ5TDP6.
PeptideAtlasiQ5TDP6.
PRIDEiQ5TDP6.

PTM databases

iPTMnetiQ5TDP6.
PhosphoSitePlusiQ5TDP6.

Expressioni

Tissue specificityi

Abundantly expressed in lens.2 Publications

Gene expression databases

BgeeiENSG00000146166.
CleanExiHS_LGSN.
ExpressionAtlasiQ5TDP6. baseline and differential.
GenevisibleiQ5TDP6. HS.

Organism-specific databases

HPAiHPA030957.

Interactioni

Subunit structurei

Dodecamer. Interacts with BFSP2 AND VIM (By similarity).By similarity

Protein-protein interaction databases

BioGridi119608. 1 interactor.
IntActiQ5TDP6. 1 interactor.
STRINGi9606.ENSP00000359691.

Structurei

3D structure databases

ProteinModelPortaliQ5TDP6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glutamine synthetase family.Curated

Phylogenomic databases

eggNOGiKOG0683. Eukaryota.
COG0174. LUCA.
GeneTreeiENSGT00390000013639.
HOGENOMiHOG000113321.
HOVERGENiHBG051740.
InParanoidiQ5TDP6.
OMAiPVQGRAN.
OrthoDBiEOG091G0IKF.
PhylomeDBiQ5TDP6.
TreeFamiTF331605.

Family and domain databases

Gene3Di3.10.20.70. 1 hit.
3.30.590.10. 1 hit.
InterProiIPR008147. Gln_synt_b-grasp.
IPR014746. Gln_synth/guanido_kin_cat_dom.
IPR008146. Gln_synth_cat_dom.
[Graphical view]
PfamiPF00120. Gln-synt_C. 1 hit.
[Graphical view]
SMARTiSM01230. Gln-synt_C. 1 hit.
[Graphical view]
SUPFAMiSSF54368. SSF54368. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5TDP6-1) [UniParc]FASTAAdd to basket
Also known as: LGS_v2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNNEEDLLQE DSTRDEGNET EANSMNTLRR TRKKVTKPYV CSTEVGETDM
60 70 80 90 100
SNSNDCMRDS SQILTPPQLS SRMKHIRQAM AKNRLQFVRF EATDLHGVSR
110 120 130 140 150
SKTIPAHFFQ EKVSHGVCMP RGYLEVIPNP KDNEMNNIRA TCFNSDIVLM
160 170 180 190 200
PELSTFRVLP WADRTARVIC DTFTVTGEPL LTSPRYIAKR QLSHLQASGF
210 220 230 240 250
SLLSAFIYDF CIFGVPEILN SKIISFPALT FLNNHDQPFM QELVDGLYHT
260 270 280 290 300
GANVESFSSS TRPGQMEISF LPEFGISSAD NAFTLRTGVK EVARKYNYIA
310 320 330 340 350
SFFIETGFCD SGILSHSLWD VDRKKNMFCS TSGTEQLTIT GKKWLAGLLK
360 370 380 390 400
HSAALSCLMA PSVSCRKRYS KDRKDLKKSV PTTWGYNDNS CIFNIKCHGE
410 420 430 440 450
KGTRIENKLG SATANPYLVL AATVAAGLDG LHSSNEVLAG PDESTDFYQV
460 470 480 490 500
EPSEIPLKLE DALVALEEDQ CLRQALGETF IRYFVAMKKY ELENEEIAAE

RNKFLEYFI
Length:509
Mass (Da):57,278
Last modified:December 21, 2004 - v1
Checksum:i86ACAC50866121BB
GO
Isoform 2 (identifier: Q5TDP6-2) [UniParc]FASTAAdd to basket
Also known as: LGS_v1

The sequence of this isoform differs from the canonical sequence as follows:
     177-208: GEPLLTSPRYIAKRQLSHLQASGFSLLSAFIY → VSGMSIGRKTCSAALLELSSSRSLGKNGWQDS
     209-509: Missing.

Show »
Length:208
Mass (Da):23,471
Checksum:i4CAA3FB3F7E13E82
GO
Isoform 3 (identifier: Q5TDP6-3) [UniParc]FASTAAdd to basket
Also known as: LGS_v3

The sequence of this isoform differs from the canonical sequence as follows:
     55-118: DCMRDSSQIL...FQEKVSHGVC → ERIRNQMVCH...PGGEFNPNSE
     119-509: Missing.

Show »
Length:118
Mass (Da):13,175
Checksum:i28AC9954C429235B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti81A → S in ABG75902 (PubMed:17010935).Curated1
Sequence conflicti472L → Q in AAF61255 (PubMed:12107413).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05455226N → Y.Corresponds to variant rs2459568dbSNPEnsembl.1
Natural variantiVAR_05455346G → E.Corresponds to variant rs35691434dbSNPEnsembl.1
Natural variantiVAR_054554137N → H.Corresponds to variant rs6454127dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03648055 – 118DCMRD…SHGVC → ERIRNQMVCHKLGNTSKPIM GPGSAESHLSYDDKDSQDET TVIKPLPPRTTTNVPGGEFN PNSE in isoform 3. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_036481119 – 509Missing in isoform 3. 1 PublicationAdd BLAST391
Alternative sequenceiVSP_036482177 – 208GEPLL…SAFIY → VSGMSIGRKTCSAALLELSS SRSLGKNGWQDS in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_036483209 – 509Missing in isoform 2. 1 PublicationAdd BLAST301

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ682605 mRNA. Translation: ABG75902.1.
DQ682606 mRNA. Translation: ABG75903.1.
AF242388 mRNA. Translation: AAF61255.1.
AL121949, AL590456 Genomic DNA. Translation: CAI20481.1.
CH471143 Genomic DNA. Translation: EAW88493.1.
BC130366 mRNA. Translation: AAI30367.1.
BC130368 mRNA. Translation: AAI30369.1.
CCDSiCCDS4964.1. [Q5TDP6-1]
CCDS55027.1. [Q5TDP6-2]
RefSeqiNP_001137412.1. NM_001143940.1. [Q5TDP6-2]
NP_057655.2. NM_016571.2. [Q5TDP6-1]
UniGeneiHs.149585.

Genome annotation databases

EnsembliENST00000370657; ENSP00000359691; ENSG00000146166. [Q5TDP6-1]
ENST00000370658; ENSP00000359692; ENSG00000146166. [Q5TDP6-2]
ENST00000622415; ENSP00000479173; ENSG00000146166. [Q5TDP6-3]
GeneIDi51557.
KEGGihsa:51557.
UCSCiuc003peh.4. human. [Q5TDP6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ682605 mRNA. Translation: ABG75902.1.
DQ682606 mRNA. Translation: ABG75903.1.
AF242388 mRNA. Translation: AAF61255.1.
AL121949, AL590456 Genomic DNA. Translation: CAI20481.1.
CH471143 Genomic DNA. Translation: EAW88493.1.
BC130366 mRNA. Translation: AAI30367.1.
BC130368 mRNA. Translation: AAI30369.1.
CCDSiCCDS4964.1. [Q5TDP6-1]
CCDS55027.1. [Q5TDP6-2]
RefSeqiNP_001137412.1. NM_001143940.1. [Q5TDP6-2]
NP_057655.2. NM_016571.2. [Q5TDP6-1]
UniGeneiHs.149585.

3D structure databases

ProteinModelPortaliQ5TDP6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119608. 1 interactor.
IntActiQ5TDP6. 1 interactor.
STRINGi9606.ENSP00000359691.

PTM databases

iPTMnetiQ5TDP6.
PhosphoSitePlusiQ5TDP6.

Polymorphism and mutation databases

BioMutaiLGSN.
DMDMi67465079.

Proteomic databases

PaxDbiQ5TDP6.
PeptideAtlasiQ5TDP6.
PRIDEiQ5TDP6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000370657; ENSP00000359691; ENSG00000146166. [Q5TDP6-1]
ENST00000370658; ENSP00000359692; ENSG00000146166. [Q5TDP6-2]
ENST00000622415; ENSP00000479173; ENSG00000146166. [Q5TDP6-3]
GeneIDi51557.
KEGGihsa:51557.
UCSCiuc003peh.4. human. [Q5TDP6-1]

Organism-specific databases

CTDi51557.
DisGeNETi51557.
GeneCardsiLGSN.
HGNCiHGNC:21016. LGSN.
HPAiHPA030957.
MIMi611470. gene.
neXtProtiNX_Q5TDP6.
OpenTargetsiENSG00000146166.
PharmGKBiPA164722103.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0683. Eukaryota.
COG0174. LUCA.
GeneTreeiENSGT00390000013639.
HOGENOMiHOG000113321.
HOVERGENiHBG051740.
InParanoidiQ5TDP6.
OMAiPVQGRAN.
OrthoDBiEOG091G0IKF.
PhylomeDBiQ5TDP6.
TreeFamiTF331605.

Miscellaneous databases

GenomeRNAii51557.
PROiQ5TDP6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000146166.
CleanExiHS_LGSN.
ExpressionAtlasiQ5TDP6. baseline and differential.
GenevisibleiQ5TDP6. HS.

Family and domain databases

Gene3Di3.10.20.70. 1 hit.
3.30.590.10. 1 hit.
InterProiIPR008147. Gln_synt_b-grasp.
IPR014746. Gln_synth/guanido_kin_cat_dom.
IPR008146. Gln_synth_cat_dom.
[Graphical view]
PfamiPF00120. Gln-synt_C. 1 hit.
[Graphical view]
SMARTiSM01230. Gln-synt_C. 1 hit.
[Graphical view]
SUPFAMiSSF54368. SSF54368. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiLGSN_HUMAN
AccessioniPrimary (citable) accession number: Q5TDP6
Secondary accession number(s): A1L421
, Q0PVN9, Q0PVP0, Q9NYJ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: December 21, 2004
Last modified: November 2, 2016
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.