Q5TAX3 (TUT4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 87.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Terminal uridylyltransferase 4 Short name=TUTase 4 EC=2.7.7.52 Alternative name(s): Zinc finger CCHC domain-containing protein 11 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1644 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Uridylyltransferase that acts as a suppressor of microRNA (miRNA) biogenesis by specifically mediating the terminal uridylation of some miRNAs. Catalyzes the 3' uridylation of precursor let-7 (pre-let-7), a miRNA precursor. Uridylated pre-let-7 miRNAs fail to be processed by Dicer and undergo degradation. Degradation of pre-let-7 contributes to the maintenance of embryonic stem (ES) cells and is required for ES cells to maintain pluripotency. Does not bind RNA by itself, recruited to pre-let-7 miRNAs via its interaction with LIN28A and LIN28B. Also catalyzes the 3' uridylation of miR-26A, a miRNA that represses IL6 transcript, leading to abrogate IL6 transcript repression and promote cytokine expression. May also suppress Toll-like receptor-induced NF-kappa-B activity via binding to T2BP. Does not play a role in replication-dependent histone mRNA degradation. Ref.6 Ref.8 Ref.9 |
| Catalytic activity | UTP + RNA(n) = diphosphate + RNA(n+1). Ref.9 |
| Cofactor | Magnesium or manganese By similarity. |
| Subunit structure | |
| Subcellular location | Nucleus. Cytoplasm. Note: Translocates into the cytoplasm following treatment of the cell with LPS. Ref.6 Ref.9 |
| Sequence similarities | Belongs to the DNA polymerase type-B-like family. Contains 3 CCHC-type zinc fingers. Contains 2 PAP-associated domains. |
| Sequence caution | The sequence CAI23477.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| TIFA | Q96CG3 | 2 | EBI-1606425,EBI-740711 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5TAX3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5TAX3-2) The sequence of this isoform differs from the canonical sequence as follows: 685-719: RSLNSQLVYEYVVERFRAAYRYFACPQTKGGNKST → LQPGRQEWKLCLKKKKKNSVKYTFIYEIQVSLFVI 720-1644: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1644 | 1644 | Terminal uridylyltransferase 4 | PRO_0000150970 | |||||
Regions | |||||||||
| Domain | 628 – 678 | 51 | PAP-associated 1 | ||||||
| Domain | 1184 – 1237 | 54 | PAP-associated 2 | ||||||
| Zinc finger | 913 – 930 | 18 | CCHC-type 1 | ||||||
| Zinc finger | 1293 – 1310 | 18 | CCHC-type 2 | ||||||
| Zinc finger | 1357 – 1374 | 18 | CCHC-type 3 | ||||||
| Compositional bias | 1398 – 1483 | 86 | Gln-rich | ||||||
| Compositional bias | 1424 – 1598 | 175 | Pro-rich | ||||||
Sites | |||||||||
| Metal binding | 1009 | 1 | Magnesium or manganese; catalytic By similarity | ||||||
| Metal binding | 1011 | 1 | Magnesium or manganese; catalytic By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 685 – 719 | 35 | RSLNS…GNKST → LQPGRQEWKLCLKKKKKNSV KYTFIYEIQVSLFVI in isoform 2. | VSP_038135 | |||||
| Alternative sequence | 720 – 1644 | 925 | Missing in isoform 2. | VSP_038136 | |||||
| Natural variant | 796 | 1 | D → Y. Corresponds to variant rs12127732 [ dbSNP | Ensembl ]. | VAR_028402 | |||||
Experimental info | |||||||||
| Mutagenesis | 1011 | 1 | D → A: Loss of nucleotidyltransferase activity. Ref.9 | ||||||
| Sequence conflict | 1313 | 1 | S → SS in AAI31735. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Thymus. |
| [2] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. |
| [5] | "Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1." Nagase T., Seki N., Ishikawa K., Tanaka A., Nomura N. DNA Res. 3:17-24(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 129-1644. Tissue: Bone marrow. |
| [6] | "A novel Zinc finger protein, ZCCHC11, interacts with TIFA and modulates TLR signaling." Minoda Y., Saeki K., Aki D., Takaki H., Sanada T., Koga K., Kobayashi T., Takaesu G., Yoshimura A. Biochem. Biophys. Res. Commun. 344:1023-1030(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH T2BP, SUBCELLULAR LOCATION. |
| [7] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Embryonic kidney. |
| [8] | "Degradation of histone mRNA requires oligouridylation followed by decapping and simultaneous degradation of the mRNA both 5' to 3' and 3' to 5'." Mullen T.E., Marzluff W.F. Genes Dev. 22:50-65(2008) [PubMed] [Europe PMC] [Abstract] Cited for: ABSENCE OF FUNCTION IN HISTONE MRNA DEGRADATION ACTIVITY. |
| [9] | "TUT4 in concert with Lin28 suppresses MicroRNA biogenesis through pre-microRNA uridylation." Heo I., Joo C., Kim Y.-K., Ha M., Yoon M.-J., Cho J., Yeom K.-H., Han J., Kim V.N. Cell 138:696-708(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY, SUBCELLULAR LOCATION, INTERACTION WITH LIN28A AND LIN28B, MUTAGENESIS OF ASP-1011. |
| [10] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK303532 mRNA. Translation: BAH13981.1. AL138849 Genomic DNA. Translation: CAI23476.1. AL138849 Genomic DNA. Translation: CAI23477.1. Sequence problems. AL138849 Genomic DNA. Translation: CAI23478.1. CH471059 Genomic DNA. Translation: EAX06778.1. CH471059 Genomic DNA. Translation: EAX06780.1. BC131734 mRNA. Translation: AAI31735.1. D83776 mRNA. Translation: BAA12105.1. |
| IPI | IPI00289861. IPI00550431. |
| RefSeq | NP_001009881.1. NM_001009881.2. NP_056084.1. NM_015269.2. |
| UniGene | Hs.655407. |
3D structure databases | |
| ProteinModelPortal | Q5TAX3. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q5TAX3. 7 interactions. |
| STRING | 9606.ENSP00000257177. |
PTM databases | |
| PhosphoSite | Q5TAX3. |
Polymorphism databases | |
| DMDM | 116242850. |
Proteomic databases | |
| PaxDb | Q5TAX3. |
| PRIDE | Q5TAX3. |
Protocols and materials databases | |
| DNASU | 23318. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000257177; ENSP00000257177; ENSG00000134744. ENST00000355809; ENSP00000348063; ENSG00000134744. ENST00000371544; ENSP00000360599; ENSG00000134744. |
| GeneID | 23318. |
| KEGG | hsa:23318. |
| UCSC | uc001ctx.2. human. |
Organism-specific databases | |
| CTD | 23318. |
| GeneCards | GC01M052888. |
| HGNC | HGNC:28981. ZCCHC11. |
| HPA | HPA027412. HPA027973. |
| MIM | 613692. gene. |
| neXtProt | NX_Q5TAX3. |
| PharmGKB | PA134918178. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5260. |
| KO | K13291. |
| OrthoDB | EOG4DZ1TJ. |
Gene expression databases | |
| ArrayExpress | Q5TAX3. |
| Bgee | Q5TAX3. |
| CleanEx | HS_ZCCHC11. |
| Genevestigator | Q5TAX3. |
| GermOnline | ENSG00000134744. Homo sapiens. |
Family and domain databases | |
| Gene3D | 4.10.60.10. 3 hits. |
| InterPro | IPR002934. Nucleotidyltransferase. IPR002058. PAP_assoc. IPR001878. Znf_CCHC. [Graphical view] |
| Pfam | PF01909. NTP_transf_2. 1 hit. PF03828. PAP_assoc. 2 hits. PF00098. zf-CCHC. 2 hits. [Graphical view] |
| SMART | SM00343. ZnF_C2HC. 3 hits. [Graphical view] |
| SUPFAM | SSF57756. SSF57756. 1 hit. |
| PROSITE | PS50158. ZF_CCHC. 3 hits. PS00028. ZINC_FINGER_C2H2_1. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | ZCCHC11. human. |
| GenomeRNAi | 23318. |
| NextBio | 45208. |
| SOURCE | Search... |
Entry information
| Entry name | TUT4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5TAX3 Secondary accession number(s): A2RRP0 Q86XZ3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
