Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DDB1- and CUL4-associated factor 8

Gene

DCAF8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.2 Publications

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

GO - Biological processi

  • protein ubiquitination Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Ubl conjugation pathway

Enzyme and pathway databases

SignaLinkiQ5TAQ9.
UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
DDB1- and CUL4-associated factor 8
Alternative name(s):
WD repeat-containing protein 42A
Gene namesi
Name:DCAF8
Synonyms:H326, WDR42A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:24891. DCAF8.

Subcellular locationi

  • Nucleus 1 Publication
  • Cytoplasm 1 Publication

  • Note: It shuttles between the nucleus and the cytoplasm. Nuclear import is mediated by KPNA1 and KPNB1 under the regulation of nuclear GTPase RAN. Nuclear export to the cytoplasm is XPO1 dependent.1 Publication

GO - Cellular componenti

  • Cul4-RING E3 ubiquitin ligase complex Source: UniProtKB
  • cytoplasm Source: UniProtKB
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Involvement in diseasei

Giant axonal neuropathy 2, autosomal dominant (GAN2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal dominant peripheral axonal neuropathy characterized by onset of distal sensory impairment with lower extremity muscle weakness and atrophy after the second decade. Clinical features include foot deformities apparent in childhood, and cardiomyopathy in severely affected individuals. Sural nerve biopsy shows giant axonal swelling with neurofilament accumulation.
See also OMIM:610100
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti317 – 3171R → C in GAN2; interaction with DDB1 is decreased. 1 Publication
Corresponds to variant rs587777425 [ dbSNP | Ensembl ].
VAR_071265

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi39 – 5012IEVEA…LSLSL → AEVEASDASASA: Abrogates cytoplasmic localization. 1 PublicationAdd
BLAST
Mutagenesisi115 – 1228RRRVQRKR → AAAVQAKA: Abrogates nuclear localization. 1 Publication
Mutagenesisi314 – 3141R → A: Reduces association with DDB1. 1 Publication
Mutagenesisi362 – 3621R → A: Reduces association with DDB1. 1 Publication

Keywords - Diseasei

Disease mutation, Neurodegeneration, Neuropathy

Organism-specific databases

MalaCardsiDCAF8.
MIMi610100. phenotype.
Orphaneti401964. Autosomal dominant Charcot-Marie-Tooth disease type 2 with giant axons.
PharmGKBiPA165751195.

Polymorphism and mutation databases

BioMutaiDCAF8.
DMDMi74756455.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 597597DDB1- and CUL4-associated factor 8PRO_0000296957Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei21 – 211PhosphoserineBy similarity
Modified residuei22 – 221PhosphoserineBy similarity
Modified residuei99 – 991PhosphoserineBy similarity
Modified residuei129 – 1291PhosphoserineBy similarity
Modified residuei130 – 1301PhosphoserineBy similarity
Modified residuei204 – 2041Omega-N-methylarginine; by PRMT11 Publication

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

EPDiQ5TAQ9.
MaxQBiQ5TAQ9.
PaxDbiQ5TAQ9.
PeptideAtlasiQ5TAQ9.
PRIDEiQ5TAQ9.

PTM databases

iPTMnetiQ5TAQ9.
PhosphoSiteiQ5TAQ9.

Expressioni

Gene expression databases

BgeeiQ5TAQ9.
CleanExiHS_WDR42A.
ExpressionAtlasiQ5TAQ9. baseline and differential.
GenevisibleiQ5TAQ9. HS.

Organism-specific databases

HPAiHPA027218.
HPA027381.

Interactioni

Subunit structurei

Interacts with DDB1, CUL4A and CUL4B. Interacts with KPNA1, KPNB1 and XPO1.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
KPNA1P522942EBI-740686,EBI-358383
MDFIQ997506EBI-740686,EBI-724076
PRMT1Q998732EBI-740686,EBI-78738
RBPMSQ930623EBI-740686,EBI-740322
SUV39H1O434632EBI-740686,EBI-349968
THAP1Q9NVV93EBI-740686,EBI-741515
vprP125202EBI-740686,EBI-6164519From a different organism.

Protein-protein interaction databases

BioGridi119121. 62 interactions.
DIPiDIP-48762N.
IntActiQ5TAQ9. 17 interactions.
MINTiMINT-1446617.
STRINGi9606.ENSP00000451235.

Structurei

Secondary structure

1
597
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Turni156 – 1638Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3I8EX-ray3.40C/D153-165[»]
ProteinModelPortaliQ5TAQ9.
SMRiQ5TAQ9. Positions 183-505.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ5TAQ9.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati191 – 23040WD 1Add
BLAST
Repeati234 – 27542WD 2Add
BLAST
Repeati281 – 32141WD 3Add
BLAST
Repeati329 – 36941WD 4Add
BLAST
Repeati385 – 42440WD 5Add
BLAST
Repeati432 – 47241WD 6Add
BLAST
Repeati476 – 51540WD 7Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi39 – 5012Nuclear export signal1 PublicationAdd
BLAST
Motifi114 – 1229Nuclear localization signal1 Publication

Sequence similaritiesi

Belongs to the WD repeat DCAF8 family.Curated
Contains 7 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG1334. Eukaryota.
KOG3133. Eukaryota.
ENOG410XQZP. LUCA.
GeneTreeiENSGT00530000062951.
HOVERGENiHBG053807.
InParanoidiQ5TAQ9.
KOiK11804.
OrthoDBiEOG7GBFX0.
PhylomeDBiQ5TAQ9.
TreeFamiTF326071.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 3 hits.
[Graphical view]
SMARTiSM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS50082. WD_REPEATS_2. 1 hit.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5TAQ9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSKGSSTDG RTDLANGSLS SSPEEMSGAE EGRETSSGIE VEASDLSLSL
60 70 80 90 100
TGDDGGPNRT STESRGTDTE SSGEDKDSDS MEDTGHYSIN DENRVHDRSE
110 120 130 140 150
EEEEEEEEEE EEQPRRRVQR KRANRDQDSS DDERALEDWV SSETSALPRP
160 170 180 190 200
RWQALPALRE RELGSSARFV YEACGARVFV QRFRLQHGLE GHTGCVNTLH
210 220 230 240 250
FNQRGTWLAS GSDDLKVVVW DWVRRQPVLD FESGHKSNVF QAKFLPNSGD
260 270 280 290 300
STLAMCARDG QVRVAELSAT QCCKNTKRVA QHKGASHKLA LEPDSPCTFL
310 320 330 340 350
SAGEDAVVFT IDLRQDRPAS KLVVTKEKEK KVGLYTIYVN PANTHQFAVG
360 370 380 390 400
GRDQFVRIYD QRKIDENENN GVLKKFCPHH LVNSESKANI TCLVYSHDGT
410 420 430 440 450
ELLASYNDED IYLFNSSHSD GAQYVKRYKG HRNNATVKGV NFYGPKSEFV
460 470 480 490 500
VSGSDCGHIF LWEKSSCQII QFMEGDKGGV VNCLEPHPHL PVLATSGLDH
510 520 530 540 550
DVKIWAPTAE ASTELTGLKD VIKKNKRERD EDSLHQTDLF DSHMLWFLMH
560 570 580 590
HLRQRRHHRR WREPGVGATD ADSDESPSSS DTSDEEEGPD RVQCMPS
Length:597
Mass (Da):66,852
Last modified:December 21, 2004 - v1
Checksum:i3F3396C77EA1E3AD
GO
Isoform 2 (identifier: Q5TAQ9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     242-273: AKFLPNSGDSTLAMCARDGQVRVAELSATQCC → VRQGSIIATERIRHELEKSELQHGLGADSELL
     274-597: Missing.

Note: No experimental confirmation available.
Show »
Length:273
Mass (Da):30,569
Checksum:i160E9D57D87F6B51
GO

Sequence cautioni

The sequence AAA16607.1 differs from that shown. Reason: Frameshift at positions 117 and 123. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti68 – 681D → E in AAH13107 (PubMed:15489334).Curated
Sequence conflicti123 – 1231A → T in AAH98271 (PubMed:15489334).Curated
Sequence conflicti155 – 1551L → F in CAH18661 (PubMed:17974005).Curated
Sequence conflicti181 – 1822QR → HG in AAA16607 (Ref. 1) Curated
Sequence conflicti237 – 2371S → G in BAD97195 (Ref. 2) Curated
Sequence conflicti375 – 3751K → E in CAH18661 (PubMed:17974005).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti317 – 3171R → C in GAN2; interaction with DDB1 is decreased. 1 Publication
Corresponds to variant rs587777425 [ dbSNP | Ensembl ].
VAR_071265

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei242 – 27332AKFLP…ATQCC → VRQGSIIATERIRHELEKSE LQHGLGADSELL in isoform 2. 1 PublicationVSP_027264Add
BLAST
Alternative sequencei274 – 597324Missing in isoform 2. 1 PublicationVSP_027265Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U06631 mRNA. Translation: AAA16607.1. Frameshift.
AK223475 mRNA. Translation: BAD97195.1.
CR749801 mRNA. Translation: CAH18661.1.
AL139011 Genomic DNA. Translation: CAI15993.1.
CH471121 Genomic DNA. Translation: EAW52731.1.
CH471121 Genomic DNA. Translation: EAW52732.1.
BC013107 mRNA. Translation: AAH13107.1.
BC080597 mRNA. Translation: AAH80597.1.
BC098271 mRNA. Translation: AAH98271.1.
BC099709 mRNA. Translation: AAH99709.1.
BC099846 mRNA. Translation: AAH99846.1.
BC111063 mRNA. Translation: AAI11064.1.
CCDSiCCDS1200.1. [Q5TAQ9-1]
RefSeqiNP_056541.2. NM_015726.3. [Q5TAQ9-1]
UniGeneiHs.632447.

Genome annotation databases

EnsembliENST00000326837; ENSP00000318227; ENSG00000132716. [Q5TAQ9-1]
ENST00000368073; ENSP00000357052; ENSG00000132716. [Q5TAQ9-1]
ENST00000368074; ENSP00000357053; ENSG00000132716. [Q5TAQ9-1]
ENST00000475733; ENSP00000476351; ENSG00000132716. [Q5TAQ9-2]
ENST00000610139; ENSP00000477464; ENSG00000132716. [Q5TAQ9-2]
GeneIDi50717.
KEGGihsa:50717.
UCSCiuc001fvn.3. human. [Q5TAQ9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U06631 mRNA. Translation: AAA16607.1. Frameshift.
AK223475 mRNA. Translation: BAD97195.1.
CR749801 mRNA. Translation: CAH18661.1.
AL139011 Genomic DNA. Translation: CAI15993.1.
CH471121 Genomic DNA. Translation: EAW52731.1.
CH471121 Genomic DNA. Translation: EAW52732.1.
BC013107 mRNA. Translation: AAH13107.1.
BC080597 mRNA. Translation: AAH80597.1.
BC098271 mRNA. Translation: AAH98271.1.
BC099709 mRNA. Translation: AAH99709.1.
BC099846 mRNA. Translation: AAH99846.1.
BC111063 mRNA. Translation: AAI11064.1.
CCDSiCCDS1200.1. [Q5TAQ9-1]
RefSeqiNP_056541.2. NM_015726.3. [Q5TAQ9-1]
UniGeneiHs.632447.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3I8EX-ray3.40C/D153-165[»]
ProteinModelPortaliQ5TAQ9.
SMRiQ5TAQ9. Positions 183-505.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119121. 62 interactions.
DIPiDIP-48762N.
IntActiQ5TAQ9. 17 interactions.
MINTiMINT-1446617.
STRINGi9606.ENSP00000451235.

PTM databases

iPTMnetiQ5TAQ9.
PhosphoSiteiQ5TAQ9.

Polymorphism and mutation databases

BioMutaiDCAF8.
DMDMi74756455.

Proteomic databases

EPDiQ5TAQ9.
MaxQBiQ5TAQ9.
PaxDbiQ5TAQ9.
PeptideAtlasiQ5TAQ9.
PRIDEiQ5TAQ9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000326837; ENSP00000318227; ENSG00000132716. [Q5TAQ9-1]
ENST00000368073; ENSP00000357052; ENSG00000132716. [Q5TAQ9-1]
ENST00000368074; ENSP00000357053; ENSG00000132716. [Q5TAQ9-1]
ENST00000475733; ENSP00000476351; ENSG00000132716. [Q5TAQ9-2]
ENST00000610139; ENSP00000477464; ENSG00000132716. [Q5TAQ9-2]
GeneIDi50717.
KEGGihsa:50717.
UCSCiuc001fvn.3. human. [Q5TAQ9-1]

Organism-specific databases

CTDi50717.
GeneCardsiDCAF8.
H-InvDBHIX0200230.
HGNCiHGNC:24891. DCAF8.
HPAiHPA027218.
HPA027381.
MalaCardsiDCAF8.
MIMi610100. phenotype.
615820. gene.
neXtProtiNX_Q5TAQ9.
Orphaneti401964. Autosomal dominant Charcot-Marie-Tooth disease type 2 with giant axons.
PharmGKBiPA165751195.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1334. Eukaryota.
KOG3133. Eukaryota.
ENOG410XQZP. LUCA.
GeneTreeiENSGT00530000062951.
HOVERGENiHBG053807.
InParanoidiQ5TAQ9.
KOiK11804.
OrthoDBiEOG7GBFX0.
PhylomeDBiQ5TAQ9.
TreeFamiTF326071.

Enzyme and pathway databases

UniPathwayiUPA00143.
SignaLinkiQ5TAQ9.

Miscellaneous databases

ChiTaRSiDCAF8. human.
EvolutionaryTraceiQ5TAQ9.
GenomeRNAii50717.
PROiQ5TAQ9.
SOURCEiSearch...

Gene expression databases

BgeeiQ5TAQ9.
CleanExiHS_WDR42A.
ExpressionAtlasiQ5TAQ9. baseline and differential.
GenevisibleiQ5TAQ9. HS.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 3 hits.
[Graphical view]
SMARTiSM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS50082. WD_REPEATS_2. 1 hit.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "H326 is a human gene homologous to murine PC326 that is ubiquitously expressed, and has a murine homologue that is also ubiquitously expressed."
    Bergsagel P.L., Kuehl W.
    Submitted (FEB-1994) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Myeloma.
  2. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Synovium.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Colon carcinoma.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain and Skin.
  7. "A family of diverse Cul4-Ddb1-interacting proteins includes Cdt2, which is required for S phase destruction of the replication factor Cdt1."
    Jin J., Arias E.E., Chen J., Harper J.W., Walter J.C.
    Mol. Cell 23:709-721(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH DDB1; CUL4A AND CUL4B, IDENTIFICATION BY MASS SPECTROMETRY, MUTAGENESIS OF ARG-314 AND ARG-362.
  8. "Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery."
    Angers S., Li T., Yi X., MacCoss M.J., Moon R.T., Zheng N.
    Nature 443:590-593(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  9. "Characterization of nuclear import and export signals determining the subcellular localization of WD repeat-containing protein 42A (WDR42A)."
    Wu F., Wang S., Xing J., Li M., Zheng C.
    FEBS Lett. 586:1079-1085(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, INTERACTION WITH KPNA1; KPNB1 AND XPO1, MUTAGENESIS OF 39-ILE--LEU-50 AND 115-ARG--ARG-122.
  10. Cited for: METHYLATION AT ARG-204 BY PRMT1, IDENTIFICATION BY MASS SPECTROMETRY.
  11. Cited for: VARIANT GAN2 CYS-317, INTERACTION WITH DDB1, CHARACTERIZATION OF VARIANT GAN2 CYS-317.

Entry informationi

Entry nameiDCAF8_HUMAN
AccessioniPrimary (citable) accession number: Q5TAQ9
Secondary accession number(s): D3DVE6
, Q12839, Q4QQI6, Q53F14, Q66K50, Q68CS7, Q96E00
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: December 21, 2004
Last modified: July 6, 2016
This is version 123 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.