Q5TAQ9 (DCAF8_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 76.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: DDB1- and CUL4-associated factor 8 Alternative name(s): WD repeat-containing protein 42A | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 597 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. Ref.8 |
| Pathway | |
| Subunit structure | Interacts with DDB1, CUL4A and CUL4B. Ref.8 |
| Sequence similarities | Belongs to the WD repeat DCAF8 family. Contains 7 WD repeats. |
| Sequence caution | The sequence AAA16607.1 differs from that shown. Reason: Frameshift at positions 117 and 123. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat WD repeat |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | protein ubiquitination Inferred by curator Ref.8. Source: UniProtKB |
| Cellular component | CUL4 RING ubiquitin ligase complex Inferred from direct assay Ref.8. Source: UniProtKB |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| MDFI | Q99750 | 3 | EBI-740686,EBI-724076 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5TAQ9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5TAQ9-2) The sequence of this isoform differs from the canonical sequence as follows: 242-273: AKFLPNSGDSTLAMCARDGQVRVAELSATQCC → VRQGSIIATERIRHELEKSELQHGLGADSELL 274-597: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 597 | 597 | DDB1- and CUL4-associated factor 8 | PRO_0000296957 | |||||||
Regions | |||||||||||
| Repeat | 191 – 230 | 40 | WD 1 | ||||||||
| Repeat | 234 – 275 | 42 | WD 2 | ||||||||
| Repeat | 281 – 321 | 41 | WD 3 | ||||||||
| Repeat | 329 – 369 | 41 | WD 4 | ||||||||
| Repeat | 385 – 424 | 40 | WD 5 | ||||||||
| Repeat | 432 – 472 | 41 | WD 6 | ||||||||
| Repeat | 476 – 515 | 40 | WD 7 | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 99 | 1 | Phosphoserine Ref.7 Ref.9 Ref.10 | ||||||||
| Modified residue | 129 | 1 | Phosphoserine Ref.7 Ref.9 Ref.10 | ||||||||
| Modified residue | 130 | 1 | Phosphoserine Ref.7 Ref.9 Ref.10 | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 242 – 273 | 32 | AKFLP…ATQCC → VRQGSIIATERIRHELEKSE LQHGLGADSELL in isoform 2. | VSP_027264 | |||||||
| Alternative sequence | 274 – 597 | 324 | Missing in isoform 2. | VSP_027265 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 314 | 1 | R → A: Reduces association with DDB1. Ref.8 | ||||||||
| Mutagenesis | 362 | 1 | R → A: Reduces association with DDB1. Ref.8 | ||||||||
| Sequence conflict | 68 | 1 | D → E in AAH13107. Ref.6 | ||||||||
| Sequence conflict | 123 | 1 | A → T in AAH98271. Ref.6 | ||||||||
| Sequence conflict | 155 | 1 | L → F in CAH18661. Ref.3 | ||||||||
| Sequence conflict | 181 – 182 | 2 | QR → HG in AAA16607. Ref.1 | ||||||||
| Sequence conflict | 237 | 1 | S → G in BAD97195. Ref.2 | ||||||||
| Sequence conflict | 375 | 1 | K → E in CAH18661. Ref.3 | ||||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Turn | 156 – 160 | 5 | |||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "H326 is a human gene homologous to murine PC326 that is ubiquitously expressed, and has a murine homologue that is also ubiquitously expressed." Bergsagel P.L., Kuehl W. Submitted (FEB-1994) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Myeloma. |
| [2] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Synovium. |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Colon carcinoma. |
| [4] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain and Skin. |
| [7] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-99; SER-129 AND SER-130, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "A family of diverse Cul4-Ddb1-interacting proteins includes Cdt2, which is required for S phase destruction of the replication factor Cdt1." Jin J., Arias E.E., Chen J., Harper J.W., Walter J.C. Mol. Cell 23:709-721(2006) [PubMed: 16949367] [Abstract] Cited for: FUNCTION, INTERACTION WITH DDB1; CUL4A AND CUL4B, IDENTIFICATION BY MASS SPECTROMETRY, MUTAGENESIS OF ARG-314 AND ARG-362. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-99; SER-129 AND SER-130, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-99; SER-129 AND SER-130, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U06631 mRNA. Translation: AAA16607.1. Frameshift. AK223475 mRNA. Translation: BAD97195.1. CR749801 mRNA. Translation: CAH18661.1. AL139011 Genomic DNA. Translation: CAI15993.1. CH471121 Genomic DNA. Translation: EAW52731.1. CH471121 Genomic DNA. Translation: EAW52732.1. BC013107 mRNA. Translation: AAH13107.1. BC080597 mRNA. Translation: AAH80597.1. BC098271 mRNA. Translation: AAH98271.1. BC099709 mRNA. Translation: AAH99709.1. BC099846 mRNA. Translation: AAH99846.1. BC111063 mRNA. Translation: AAI11064.1. | ||||||||||||
| IPI | IPI00290071. IPI00854775. | ||||||||||||
| RefSeq | NP_056541.2. NM_015726.3. | ||||||||||||
| UniGene | Hs.632447. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q5TAQ9. | ||||||||||||
| SMR | Q5TAQ9. Positions 158-508. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-48762N. | ||||||||||||
| IntAct | Q5TAQ9. 4 interactions. | ||||||||||||
| MINT | MINT-1446617. | ||||||||||||
| STRING | Q5TAQ9. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q5TAQ9. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 74756455. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q5TAQ9. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000326837; ENSP00000318227; ENSG00000132716. ENST00000368073; ENSP00000357052; ENSG00000132716. ENST00000368074; ENSP00000357053; ENSG00000132716. | ||||||||||||
| GeneID | 50717. | ||||||||||||
| KEGG | hsa:50717. | ||||||||||||
| UCSC | uc001fvn.1. human. uc001fvp.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 50717. | ||||||||||||
| GeneCards | GC01M160185. | ||||||||||||
| H-InvDB | HIX0020510. HIX0028423. | ||||||||||||
| HGNC | HGNC:24891. DCAF8. | ||||||||||||
| HPA | HPA027218. HPA027381. | ||||||||||||
| neXtProt | NX_Q5TAQ9. | ||||||||||||
| PharmGKB | PA134953598. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| GeneTree | ENSGT00530000062951. | ||||||||||||
| HOVERGEN | HBG053807. | ||||||||||||
| InParanoid | Q5TAQ9. | ||||||||||||
| OMA | GAQYIKR. | ||||||||||||
| OrthoDB | EOG47H5PN. | ||||||||||||
| PhylomeDB | Q5TAQ9. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q5TAQ9. | ||||||||||||
| Bgee | Q5TAQ9. | ||||||||||||
| CleanEx | HS_WDR42A. | ||||||||||||
| Genevestigator | Q5TAQ9. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR015943. WD40/YVTN_repeat-like_dom. IPR001680. WD40_repeat. IPR011046. WD40_repeat-like_dom. IPR017986. WD40_repeat_dom. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:2.130.10.10. WD40/YVTN_repeat-like. 2 hits. | ||||||||||||
| KO | K11804. | ||||||||||||
| Pfam | PF00400. WD40. 4 hits. [Graphical view] | ||||||||||||
| SMART | SM00320. WD40. 7 hits. [Graphical view] | ||||||||||||
| SUPFAM | SSF50978. WD40_like. 1 hit. | ||||||||||||
| PROSITE | PS00678. WD_REPEATS_1. False negative. PS50082. WD_REPEATS_2. 1 hit. PS50294. WD_REPEATS_REGION. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 53224. | ||||||||||||
Entry information
| Entry name | DCAF8_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5TAQ9 Secondary accession number(s): D3DVE6 Q96E00 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with