Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q5TAA0 (TTC22_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 79. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Tetratricopeptide repeat protein 22

Short name=TPR repeat protein 22
Gene names
Name:TTC22
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length569 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Sequence similarities

Contains 7 TPR repeats.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
TPR repeat
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q5TAA0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q5TAA0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     341-372: IHIRAYLHDLKRAKMGLGGMPDRNHLACAKAD → RRGLTMLPRLVSNSWAQAVLPPRPPKVLEFQV
     373-569: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 569569Tetratricopeptide repeat protein 22
PRO_0000263098

Regions

Repeat66 – 9934TPR 1
Repeat101 – 13333TPR 2
Repeat203 – 23735TPR 3
Repeat260 – 29435TPR 4
Repeat295 – 32834TPR 5
Repeat383 – 41836TPR 6
Repeat432 – 46534TPR 7

Natural variations

Alternative sequence341 – 37232IHIRA…CAKAD → RRGLTMLPRLVSNSWAQAVL PPRPPKVLEFQV in isoform 2.
VSP_021859
Alternative sequence373 – 569197Missing in isoform 2.
VSP_021860
Natural variant141L → V.
Corresponds to variant rs671108 [ dbSNP | Ensembl ].
VAR_029585

Experimental info

Sequence conflict2291R → H in BAA91293. Ref.1
Sequence conflict3241V → A in BAA91293. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 21, 2004. Version 1.
Checksum: 95AFA00228FF6402

FASTA56963,361
        10         20         30         40         50         60 
MAELEAVADD LDALIDDLDY LPGHFHLEMQ LNFEPRSPAP QRARDLKLQR EGLRQELQLA 

        70         80         90        100        110        120 
AAPQRPAVRH LLGAFAFYLE ELDEARECFL EVAHEHPGNL NAWANLAHVY GRLGQEEEEE 

       130        140        150        160        170        180 
ACAARLADLM GLAEEPEAAG DPQLRAARCL AEQGYAHGFD VGCASPEERA RGLAAGIALY 

       190        200        210        220        230        240 
DKALGYGQQI PMEEKRGWYF TMATLYIRLD GIFLELGSEE QKRLPAFNRT LALLRQVLKS 

       250        260        270        280        290        300 
EDPRHRALAW CYLGMLLERK DTFSTTPMGV HDCGYSGTDP LDCFGKAIEI AKNQPPILNR 

       310        320        330        340        350        360 
LAKIFYFLGK QDMAIGTCNM ALDVLRDPEL NWQAYCTRAK IHIRAYLHDL KRAKMGLGGM 

       370        380        390        400        410        420 
PDRNHLACAK ADLEEVVRVC PGFKAYLDIG QVYYYMGVDA VQELLAVDEA ALNQALVFLA 

       430        440        450        460        470        480 
KAGESELGAT LPELQLLRGK CLRIKGEDAN AAACFKRAVE LDDAGSSHTD GFGCLLEALL 

       490        500        510        520        530        540 
AQWSQAQLSD GELGREVDAW LRRAQDKYPA ARLRQELQRV WRGHTDEVLG LARALVAQGR 

       550        560 
PALVRLLFET MEREGEGASA PRDRRAVSF 

« Hide

Isoform 2 [UniParc].

Checksum: 79C116A687D3C5E4
Show »

FASTA37241,790

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Carcinoma.
[2]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK000626 mRNA. Translation: BAA91293.1.
AL139244, AC096536 Genomic DNA. Translation: CAI18990.1.
CCDSCCDS44152.1. [Q5TAA0-1]
CCDS598.1. [Q5TAA0-2]
RefSeqNP_001107580.1. NM_001114108.1. [Q5TAA0-1]
NP_060374.2. NM_017904.3. [Q5TAA0-2]
UniGeneHs.16230.

3D structure databases

ProteinModelPortalQ5TAA0.
SMRQ5TAA0. Positions 66-96, 280-333.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000360323.

PTM databases

PhosphoSiteQ5TAA0.

Polymorphism databases

DMDM74745799.

Proteomic databases

PaxDbQ5TAA0.
PRIDEQ5TAA0.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000371274; ENSP00000360321; ENSG00000006555. [Q5TAA0-2]
ENST00000371276; ENSP00000360323; ENSG00000006555. [Q5TAA0-1]
GeneID55001.
KEGGhsa:55001.
UCSCuc001cxz.4. human. [Q5TAA0-2]
uc009vzt.1. human. [Q5TAA0-1]

Organism-specific databases

CTD55001.
GeneCardsGC01M055246.
HGNCHGNC:26067. TTC22.
HPAHPA035072.
neXtProtNX_Q5TAA0.
PharmGKBPA142670674.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG26130.
HOGENOMHOG000232031.
HOVERGENHBG080526.
InParanoidQ5TAA0.
OMAACFKRAV.
OrthoDBEOG7W153K.
PhylomeDBQ5TAA0.
TreeFamTF331828.

Gene expression databases

ArrayExpressQ5TAA0.
BgeeQ5TAA0.
CleanExHS_TTC22.
GenevestigatorQ5TAA0.

Family and domain databases

Gene3D1.25.40.10. 3 hits.
InterProIPR011990. TPR-like_helical.
IPR013105. TPR_2.
IPR019734. TPR_repeat.
[Graphical view]
PfamPF07719. TPR_2. 1 hit.
[Graphical view]
SMARTSM00028. TPR. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi55001.
NextBio58324.
PROQ5TAA0.

Entry information

Entry nameTTC22_HUMAN
AccessionPrimary (citable) accession number: Q5TAA0
Secondary accession number(s): Q9NWT4
Entry history
Integrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: December 21, 2004
Last modified: July 9, 2014
This is version 79 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM