SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q5TAA0

- TTC22_HUMAN

UniProt

Q5TAA0 - TTC22_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Tetratricopeptide repeat protein 22

Gene
TTC22
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5 - Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Tetratricopeptide repeat protein 22
Short name:
TPR repeat protein 22
Gene namesi
Name:TTC22
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:26067. TTC22.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142670674.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 569569Tetratricopeptide repeat protein 22PRO_0000263098Add
BLAST

Proteomic databases

PaxDbiQ5TAA0.
PRIDEiQ5TAA0.

PTM databases

PhosphoSiteiQ5TAA0.

Expressioni

Gene expression databases

ArrayExpressiQ5TAA0.
BgeeiQ5TAA0.
CleanExiHS_TTC22.
GenevestigatoriQ5TAA0.

Organism-specific databases

HPAiHPA035072.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000360323.

Structurei

3D structure databases

ProteinModelPortaliQ5TAA0.
SMRiQ5TAA0. Positions 66-96, 280-333.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati66 – 9934TPR 1Add
BLAST
Repeati101 – 13333TPR 2Add
BLAST
Repeati203 – 23735TPR 3Add
BLAST
Repeati260 – 29435TPR 4Add
BLAST
Repeati295 – 32834TPR 5Add
BLAST
Repeati383 – 41836TPR 6Add
BLAST
Repeati432 – 46534TPR 7Add
BLAST

Sequence similaritiesi

Contains 7 TPR repeats.

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

eggNOGiNOG26130.
HOGENOMiHOG000232031.
HOVERGENiHBG080526.
InParanoidiQ5TAA0.
OMAiACFKRAV.
OrthoDBiEOG7W153K.
PhylomeDBiQ5TAA0.
TreeFamiTF331828.

Family and domain databases

Gene3Di1.25.40.10. 3 hits.
InterProiIPR011990. TPR-like_helical.
IPR013105. TPR_2.
IPR019734. TPR_repeat.
[Graphical view]
PfamiPF07719. TPR_2. 1 hit.
[Graphical view]
SMARTiSM00028. TPR. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q5TAA0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAELEAVADD LDALIDDLDY LPGHFHLEMQ LNFEPRSPAP QRARDLKLQR    50
EGLRQELQLA AAPQRPAVRH LLGAFAFYLE ELDEARECFL EVAHEHPGNL 100
NAWANLAHVY GRLGQEEEEE ACAARLADLM GLAEEPEAAG DPQLRAARCL 150
AEQGYAHGFD VGCASPEERA RGLAAGIALY DKALGYGQQI PMEEKRGWYF 200
TMATLYIRLD GIFLELGSEE QKRLPAFNRT LALLRQVLKS EDPRHRALAW 250
CYLGMLLERK DTFSTTPMGV HDCGYSGTDP LDCFGKAIEI AKNQPPILNR 300
LAKIFYFLGK QDMAIGTCNM ALDVLRDPEL NWQAYCTRAK IHIRAYLHDL 350
KRAKMGLGGM PDRNHLACAK ADLEEVVRVC PGFKAYLDIG QVYYYMGVDA 400
VQELLAVDEA ALNQALVFLA KAGESELGAT LPELQLLRGK CLRIKGEDAN 450
AAACFKRAVE LDDAGSSHTD GFGCLLEALL AQWSQAQLSD GELGREVDAW 500
LRRAQDKYPA ARLRQELQRV WRGHTDEVLG LARALVAQGR PALVRLLFET 550
MEREGEGASA PRDRRAVSF 569
Length:569
Mass (Da):63,361
Last modified:December 21, 2004 - v1
Checksum:i95AFA00228FF6402
GO
Isoform 2 (identifier: Q5TAA0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     341-372: IHIRAYLHDLKRAKMGLGGMPDRNHLACAKAD → RRGLTMLPRLVSNSWAQAVLPPRPPKVLEFQV
     373-569: Missing.

Note: No experimental confirmation available.

Show »
Length:372
Mass (Da):41,790
Checksum:i79C116A687D3C5E4
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti14 – 141L → V.
Corresponds to variant rs671108 [ dbSNP | Ensembl ].
VAR_029585

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei341 – 37232IHIRA…CAKAD → RRGLTMLPRLVSNSWAQAVL PPRPPKVLEFQV in isoform 2. VSP_021859Add
BLAST
Alternative sequencei373 – 569197Missing in isoform 2. VSP_021860Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti229 – 2291R → H in BAA91293. 1 Publication
Sequence conflicti324 – 3241V → A in BAA91293. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK000626 mRNA. Translation: BAA91293.1.
AL139244, AC096536 Genomic DNA. Translation: CAI18990.1.
CCDSiCCDS44152.1. [Q5TAA0-1]
CCDS598.1. [Q5TAA0-2]
RefSeqiNP_001107580.1. NM_001114108.1. [Q5TAA0-1]
NP_060374.2. NM_017904.3. [Q5TAA0-2]
UniGeneiHs.16230.

Genome annotation databases

EnsembliENST00000371274; ENSP00000360321; ENSG00000006555. [Q5TAA0-2]
ENST00000371276; ENSP00000360323; ENSG00000006555. [Q5TAA0-1]
GeneIDi55001.
KEGGihsa:55001.
UCSCiuc001cxz.4. human. [Q5TAA0-2]
uc009vzt.1. human. [Q5TAA0-1]

Polymorphism databases

DMDMi74745799.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK000626 mRNA. Translation: BAA91293.1 .
AL139244 , AC096536 Genomic DNA. Translation: CAI18990.1 .
CCDSi CCDS44152.1. [Q5TAA0-1 ]
CCDS598.1. [Q5TAA0-2 ]
RefSeqi NP_001107580.1. NM_001114108.1. [Q5TAA0-1 ]
NP_060374.2. NM_017904.3. [Q5TAA0-2 ]
UniGenei Hs.16230.

3D structure databases

ProteinModelPortali Q5TAA0.
SMRi Q5TAA0. Positions 66-96, 280-333.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000360323.

PTM databases

PhosphoSitei Q5TAA0.

Polymorphism databases

DMDMi 74745799.

Proteomic databases

PaxDbi Q5TAA0.
PRIDEi Q5TAA0.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000371274 ; ENSP00000360321 ; ENSG00000006555 . [Q5TAA0-2 ]
ENST00000371276 ; ENSP00000360323 ; ENSG00000006555 . [Q5TAA0-1 ]
GeneIDi 55001.
KEGGi hsa:55001.
UCSCi uc001cxz.4. human. [Q5TAA0-2 ]
uc009vzt.1. human. [Q5TAA0-1 ]

Organism-specific databases

CTDi 55001.
GeneCardsi GC01M055246.
HGNCi HGNC:26067. TTC22.
HPAi HPA035072.
neXtProti NX_Q5TAA0.
PharmGKBi PA142670674.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG26130.
HOGENOMi HOG000232031.
HOVERGENi HBG080526.
InParanoidi Q5TAA0.
OMAi ACFKRAV.
OrthoDBi EOG7W153K.
PhylomeDBi Q5TAA0.
TreeFami TF331828.

Miscellaneous databases

GenomeRNAii 55001.
NextBioi 58324.
PROi Q5TAA0.

Gene expression databases

ArrayExpressi Q5TAA0.
Bgeei Q5TAA0.
CleanExi HS_TTC22.
Genevestigatori Q5TAA0.

Family and domain databases

Gene3Di 1.25.40.10. 3 hits.
InterProi IPR011990. TPR-like_helical.
IPR013105. TPR_2.
IPR019734. TPR_repeat.
[Graphical view ]
Pfami PF07719. TPR_2. 1 hit.
[Graphical view ]
SMARTi SM00028. TPR. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Carcinoma.
  2. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiTTC22_HUMAN
AccessioniPrimary (citable) accession number: Q5TAA0
Secondary accession number(s): Q9NWT4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: December 21, 2004
Last modified: July 9, 2014
This is version 79 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi