Q5TAA0 (TTC22_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 69.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tetratricopeptide repeat protein 22 Short name=TPR repeat protein 22 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 569 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence similarities | Contains 7 TPR repeats. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat TPR repeat |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5TAA0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5TAA0-2) The sequence of this isoform differs from the canonical sequence as follows: 341-372: IHIRAYLHDLKRAKMGLGGMPDRNHLACAKAD → RRGLTMLPRLVSNSWAQAVLPPRPPKVLEFQV 373-569: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 569 | 569 | Tetratricopeptide repeat protein 22 | PRO_0000263098 | |||||
Regions | |||||||||
| Repeat | 66 – 99 | 34 | TPR 1 | ||||||
| Repeat | 101 – 133 | 33 | TPR 2 | ||||||
| Repeat | 203 – 237 | 35 | TPR 3 | ||||||
| Repeat | 260 – 294 | 35 | TPR 4 | ||||||
| Repeat | 295 – 328 | 34 | TPR 5 | ||||||
| Repeat | 383 – 418 | 36 | TPR 6 | ||||||
| Repeat | 432 – 465 | 34 | TPR 7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 341 – 372 | 32 | IHIRA…CAKAD → RRGLTMLPRLVSNSWAQAVL PPRPPKVLEFQV in isoform 2. | VSP_021859 | |||||
| Alternative sequence | 373 – 569 | 197 | Missing in isoform 2. | VSP_021860 | |||||
| Natural variant | 14 | 1 | L → V. Corresponds to variant rs671108 [ dbSNP | Ensembl ]. | VAR_029585 | |||||
Experimental info | |||||||||
| Sequence conflict | 229 | 1 | R → H in BAA91293. Ref.1 | ||||||
| Sequence conflict | 324 | 1 | V → A in BAA91293. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Carcinoma. |
| [2] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK000626 mRNA. Translation: BAA91293.1. AL139244, AC096536 Genomic DNA. Translation: CAI18990.1. |
| IPI | IPI00016663. IPI00514025. |
| RefSeq | NP_001107580.1. NM_001114108.1. NP_060374.2. NM_017904.3. |
| UniGene | Hs.16230. |
3D structure databases | |
| ProteinModelPortal | Q5TAA0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000360323. |
PTM databases | |
| PhosphoSite | Q5TAA0. |
Polymorphism databases | |
| DMDM | 74745799. |
Proteomic databases | |
| PaxDb | Q5TAA0. |
| PRIDE | Q5TAA0. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000371274; ENSP00000360321; ENSG00000006555. ENST00000371276; ENSP00000360323; ENSG00000006555. |
| GeneID | 55001. |
| KEGG | hsa:55001. |
| UCSC | uc001cxz.4. human. uc009vzt.1. human. |
Organism-specific databases | |
| CTD | 55001. |
| GeneCards | GC01M055246. |
| HGNC | HGNC:26067. TTC22. |
| HPA | HPA035072. |
| neXtProt | NX_Q5TAA0. |
| PharmGKB | PA142670674. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG26130. |
| HOGENOM | HOG000232031. |
| HOVERGEN | HBG080526. |
| InParanoid | Q5TAA0. |
| OMA | REDPGNL. |
| OrthoDB | EOG4F7NJS. |
Gene expression databases | |
| ArrayExpress | Q5TAA0. |
| Bgee | Q5TAA0. |
| CleanEx | HS_TTC22. |
| Genevestigator | Q5TAA0. |
| GermOnline | ENSG00000006555. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.25.40.10. 3 hits. |
| InterPro | IPR011990. TPR-like_helical. IPR013105. TPR_2. IPR019734. TPR_repeat. [Graphical view] |
| Pfam | PF07719. TPR_2. 1 hit. [Graphical view] |
| SMART | SM00028. TPR. 3 hits. [Graphical view] |
| PROSITE | PS50005. TPR. False negative. PS50293. TPR_REGION. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 55001. |
| NextBio | 58324. |
Entry information
| Entry name | TTC22_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5TAA0 Secondary accession number(s): Q9NWT4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
