Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5TAA0

- TTC22_HUMAN

UniProt

Q5TAA0 - TTC22_HUMAN

Protein

Tetratricopeptide repeat protein 22

Gene

TTC22

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 80 (01 Oct 2014)
      Sequence version 1 (21 Dec 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Tetratricopeptide repeat protein 22
    Short name:
    TPR repeat protein 22
    Gene namesi
    Name:TTC22
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:26067. TTC22.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142670674.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 569569Tetratricopeptide repeat protein 22PRO_0000263098Add
    BLAST

    Proteomic databases

    PaxDbiQ5TAA0.
    PRIDEiQ5TAA0.

    PTM databases

    PhosphoSiteiQ5TAA0.

    Expressioni

    Gene expression databases

    ArrayExpressiQ5TAA0.
    BgeeiQ5TAA0.
    CleanExiHS_TTC22.
    GenevestigatoriQ5TAA0.

    Organism-specific databases

    HPAiHPA035072.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000360323.

    Structurei

    3D structure databases

    ProteinModelPortaliQ5TAA0.
    SMRiQ5TAA0. Positions 66-96, 280-333.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati66 – 9934TPR 1Add
    BLAST
    Repeati101 – 13333TPR 2Add
    BLAST
    Repeati203 – 23735TPR 3Add
    BLAST
    Repeati260 – 29435TPR 4Add
    BLAST
    Repeati295 – 32834TPR 5Add
    BLAST
    Repeati383 – 41836TPR 6Add
    BLAST
    Repeati432 – 46534TPR 7Add
    BLAST

    Sequence similaritiesi

    Contains 7 TPR repeats.Curated

    Keywords - Domaini

    Repeat, TPR repeat

    Phylogenomic databases

    eggNOGiNOG26130.
    HOGENOMiHOG000232031.
    HOVERGENiHBG080526.
    InParanoidiQ5TAA0.
    OMAiACFKRAV.
    OrthoDBiEOG7W153K.
    PhylomeDBiQ5TAA0.
    TreeFamiTF331828.

    Family and domain databases

    Gene3Di1.25.40.10. 3 hits.
    InterProiIPR011990. TPR-like_helical.
    IPR013105. TPR_2.
    IPR019734. TPR_repeat.
    [Graphical view]
    PfamiPF07719. TPR_2. 1 hit.
    [Graphical view]
    SMARTiSM00028. TPR. 3 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5TAA0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAELEAVADD LDALIDDLDY LPGHFHLEMQ LNFEPRSPAP QRARDLKLQR    50
    EGLRQELQLA AAPQRPAVRH LLGAFAFYLE ELDEARECFL EVAHEHPGNL 100
    NAWANLAHVY GRLGQEEEEE ACAARLADLM GLAEEPEAAG DPQLRAARCL 150
    AEQGYAHGFD VGCASPEERA RGLAAGIALY DKALGYGQQI PMEEKRGWYF 200
    TMATLYIRLD GIFLELGSEE QKRLPAFNRT LALLRQVLKS EDPRHRALAW 250
    CYLGMLLERK DTFSTTPMGV HDCGYSGTDP LDCFGKAIEI AKNQPPILNR 300
    LAKIFYFLGK QDMAIGTCNM ALDVLRDPEL NWQAYCTRAK IHIRAYLHDL 350
    KRAKMGLGGM PDRNHLACAK ADLEEVVRVC PGFKAYLDIG QVYYYMGVDA 400
    VQELLAVDEA ALNQALVFLA KAGESELGAT LPELQLLRGK CLRIKGEDAN 450
    AAACFKRAVE LDDAGSSHTD GFGCLLEALL AQWSQAQLSD GELGREVDAW 500
    LRRAQDKYPA ARLRQELQRV WRGHTDEVLG LARALVAQGR PALVRLLFET 550
    MEREGEGASA PRDRRAVSF 569
    Length:569
    Mass (Da):63,361
    Last modified:December 21, 2004 - v1
    Checksum:i95AFA00228FF6402
    GO
    Isoform 2 (identifier: Q5TAA0-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         341-372: IHIRAYLHDLKRAKMGLGGMPDRNHLACAKAD → RRGLTMLPRLVSNSWAQAVLPPRPPKVLEFQV
         373-569: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:372
    Mass (Da):41,790
    Checksum:i79C116A687D3C5E4
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti229 – 2291R → H in BAA91293. (PubMed:14702039)Curated
    Sequence conflicti324 – 3241V → A in BAA91293. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti14 – 141L → V.
    Corresponds to variant rs671108 [ dbSNP | Ensembl ].
    VAR_029585

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei341 – 37232IHIRA…CAKAD → RRGLTMLPRLVSNSWAQAVL PPRPPKVLEFQV in isoform 2. 1 PublicationVSP_021859Add
    BLAST
    Alternative sequencei373 – 569197Missing in isoform 2. 1 PublicationVSP_021860Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK000626 mRNA. Translation: BAA91293.1.
    AL139244, AC096536 Genomic DNA. Translation: CAI18990.1.
    CCDSiCCDS44152.1. [Q5TAA0-1]
    CCDS598.1. [Q5TAA0-2]
    RefSeqiNP_001107580.1. NM_001114108.1. [Q5TAA0-1]
    NP_060374.2. NM_017904.3. [Q5TAA0-2]
    UniGeneiHs.16230.

    Genome annotation databases

    EnsembliENST00000371274; ENSP00000360321; ENSG00000006555. [Q5TAA0-2]
    ENST00000371276; ENSP00000360323; ENSG00000006555. [Q5TAA0-1]
    GeneIDi55001.
    KEGGihsa:55001.
    UCSCiuc001cxz.4. human. [Q5TAA0-2]
    uc009vzt.1. human. [Q5TAA0-1]

    Polymorphism databases

    DMDMi74745799.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK000626 mRNA. Translation: BAA91293.1 .
    AL139244 , AC096536 Genomic DNA. Translation: CAI18990.1 .
    CCDSi CCDS44152.1. [Q5TAA0-1 ]
    CCDS598.1. [Q5TAA0-2 ]
    RefSeqi NP_001107580.1. NM_001114108.1. [Q5TAA0-1 ]
    NP_060374.2. NM_017904.3. [Q5TAA0-2 ]
    UniGenei Hs.16230.

    3D structure databases

    ProteinModelPortali Q5TAA0.
    SMRi Q5TAA0. Positions 66-96, 280-333.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000360323.

    PTM databases

    PhosphoSitei Q5TAA0.

    Polymorphism databases

    DMDMi 74745799.

    Proteomic databases

    PaxDbi Q5TAA0.
    PRIDEi Q5TAA0.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000371274 ; ENSP00000360321 ; ENSG00000006555 . [Q5TAA0-2 ]
    ENST00000371276 ; ENSP00000360323 ; ENSG00000006555 . [Q5TAA0-1 ]
    GeneIDi 55001.
    KEGGi hsa:55001.
    UCSCi uc001cxz.4. human. [Q5TAA0-2 ]
    uc009vzt.1. human. [Q5TAA0-1 ]

    Organism-specific databases

    CTDi 55001.
    GeneCardsi GC01M055246.
    HGNCi HGNC:26067. TTC22.
    HPAi HPA035072.
    neXtProti NX_Q5TAA0.
    PharmGKBi PA142670674.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG26130.
    HOGENOMi HOG000232031.
    HOVERGENi HBG080526.
    InParanoidi Q5TAA0.
    OMAi ACFKRAV.
    OrthoDBi EOG7W153K.
    PhylomeDBi Q5TAA0.
    TreeFami TF331828.

    Miscellaneous databases

    GenomeRNAii 55001.
    NextBioi 58324.
    PROi Q5TAA0.

    Gene expression databases

    ArrayExpressi Q5TAA0.
    Bgeei Q5TAA0.
    CleanExi HS_TTC22.
    Genevestigatori Q5TAA0.

    Family and domain databases

    Gene3Di 1.25.40.10. 3 hits.
    InterProi IPR011990. TPR-like_helical.
    IPR013105. TPR_2.
    IPR019734. TPR_repeat.
    [Graphical view ]
    Pfami PF07719. TPR_2. 1 hit.
    [Graphical view ]
    SMARTi SM00028. TPR. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Carcinoma.
    2. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

    Entry informationi

    Entry nameiTTC22_HUMAN
    AccessioniPrimary (citable) accession number: Q5TAA0
    Secondary accession number(s): Q9NWT4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 12, 2006
    Last sequence update: December 21, 2004
    Last modified: October 1, 2014
    This is version 80 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3