Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein wntless homolog

Gene

WLS

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulates Wnt proteins sorting and secretion in a feedback regulatory mechanism. This reciprocal interaction plays a key role in the regulation of expression, subcellular location, binding and organelle-specific association of Wnt proteins. Plays also an important role in establishment of the anterior-posterior body axis formation during development (By similarity).By similarity2 Publications

GO - Molecular functioni

  • signal transducer activity Source: UniProtKB
  • Wnt-protein binding Source: WormBase

GO - Biological processi

  • anterior/posterior axis specification Source: UniProtKB
  • exocrine pancreas development Source: Ensembl
  • hindbrain development Source: Ensembl
  • intracellular protein transport Source: ParkinsonsUK-UCL
  • mesoderm formation Source: Ensembl
  • midbrain development Source: Ensembl
  • positive regulation of canonical Wnt signaling pathway Source: BHF-UCL
  • positive regulation of I-kappaB kinase/NF-kappaB signaling Source: UniProtKB
  • positive regulation of Wnt protein secretion Source: ParkinsonsUK-UCL
  • positive regulation of Wnt signaling pathway Source: ParkinsonsUK-UCL
  • Wnt protein secretion Source: WormBase
  • Wnt signaling pathway Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Wnt signaling pathway

Enzyme and pathway databases

ReactomeiR-HSA-3238698. WNT ligand biogenesis and trafficking.

Protein family/group databases

TCDBi8.A.56.1.2. the wntless protein (wls) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein wntless homolog
Alternative name(s):
Integral membrane protein GPR177
Protein evenness interrupted homolog
Short name:
EVI
Putative NF-kappa-B-activating protein 373
Gene namesi
Name:WLS
Synonyms:C1orf139, GPR177
ORF Names:UNQ85/PRO18667
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:30238. WLS.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini43 – 232190LumenalSequence analysisAdd
BLAST
Transmembranei233 – 25321Helical; Name=1Sequence analysisAdd
BLAST
Topological domaini254 – 26815CytoplasmicSequence analysisAdd
BLAST
Transmembranei269 – 28921Helical; Name=2Sequence analysisAdd
BLAST
Topological domaini290 – 30314LumenalSequence analysisAdd
BLAST
Transmembranei304 – 32421Helical; Name=3Sequence analysisAdd
BLAST
Topological domaini325 – 3317CytoplasmicSequence analysis
Transmembranei332 – 35221Helical; Name=4Sequence analysisAdd
BLAST
Topological domaini353 – 38028LumenalSequence analysisAdd
BLAST
Transmembranei381 – 40121Helical; Name=5Sequence analysisAdd
BLAST
Topological domaini402 – 43130CytoplasmicSequence analysisAdd
BLAST
Transmembranei432 – 45221Helical; Name=6Sequence analysisAdd
BLAST
Topological domaini453 – 47119LumenalSequence analysisAdd
BLAST
Transmembranei472 – 49221Helical; Name=7Sequence analysisAdd
BLAST
Topological domaini493 – 54149CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • cytoplasmic, membrane-bounded vesicle Source: ParkinsonsUK-UCL
  • cytoplasmic vesicle Source: WormBase
  • dendrite cytoplasm Source: Ensembl
  • dendrite membrane Source: Ensembl
  • early endosome Source: ParkinsonsUK-UCL
  • early endosome membrane Source: Reactome
  • endocytic vesicle membrane Source: Reactome
  • endoplasmic reticulum membrane Source: WormBase
  • extracellular exosome Source: Reactome
  • Golgi apparatus Source: ParkinsonsUK-UCL
  • Golgi membrane Source: WormBase
  • integral component of membrane Source: UniProtKB-KW
  • plasma membrane Source: WormBase
  • trans-Golgi network Source: ParkinsonsUK-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasmic vesicle, Endoplasmic reticulum, Endosome, Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA165752781.

Polymorphism and mutation databases

BioMutaiWLS.
DMDMi122063496.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 4242Sequence analysisAdd
BLAST
Chaini43 – 541499Protein wntless homologPRO_0000271777Add
BLAST

Proteomic databases

EPDiQ5T9L3.
MaxQBiQ5T9L3.
PaxDbiQ5T9L3.
PRIDEiQ5T9L3.

PTM databases

iPTMnetiQ5T9L3.
PhosphoSiteiQ5T9L3.

Expressioni

Gene expression databases

BgeeiQ5T9L3.
CleanExiHS_GPR177.
ExpressionAtlasiQ5T9L3. baseline and differential.
GenevisibleiQ5T9L3. HS.

Interactioni

Subunit structurei

Interacts with WNT3A. Interacts with WNT1, WNT3 and WNT5A (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
OPRM1P3537210EBI-2868748,EBI-2624570

GO - Molecular functioni

  • Wnt-protein binding Source: WormBase

Protein-protein interaction databases

BioGridi123038. 19 interactions.
IntActiQ5T9L3. 9 interactions.
STRINGi9606.ENSP00000346829.

Structurei

3D structure databases

ProteinModelPortaliQ5T9L3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni101 – 232132Interacts with Wnt proteinsBy similarityAdd
BLAST

Sequence similaritiesi

Belongs to the wntless family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IG2W. Eukaryota.
ENOG410XQ06. LUCA.
GeneTreeiENSGT00390000005897.
HOGENOMiHOG000039226.
HOVERGENiHBG055794.
InParanoidiQ5T9L3.
OMAiLDYSRWQ.
OrthoDBiEOG7B05CP.
PhylomeDBiQ5T9L3.
TreeFamiTF105975.

Family and domain databases

InterProiIPR009551. Wntless.
[Graphical view]
PANTHERiPTHR13449. PTHR13449. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5T9L3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGAIIENMS TKKLCIVGGI LLVFQIIAFL VGGLIAPGPT TAVSYMSVKC
60 70 80 90 100
VDARKNHHKT KWFVPWGPNH CDKIRDIEEA IPREIEANDI VFSVHIPLPH
110 120 130 140 150
MEMSPWFQFM LFILQLDIAF KLNNQIRENA EVSMDVSLAY RDDAFAEWTE
160 170 180 190 200
MAHERVPRKL KCTFTSPKTP EHEGRYYECD VLPFMEIGSV AHKFYLLNIR
210 220 230 240 250
LPVNEKKKIN VGIGEIKDIR LVGIHQNGGF TKVWFAMKTF LTPSIFIIMV
260 270 280 290 300
WYWRRITMMS RPPVLLEKVI FALGISMTFI NIPVEWFSIG FDWTWMLLFG
310 320 330 340 350
DIRQGIFYAM LLSFWIIFCG EHMMDQHERN HIAGYWKQVG PIAVGSFCLF
360 370 380 390 400
IFDMCERGVQ LTNPFYSIWT TDIGTELAMA FIIVAGICLC LYFLFLCFMV
410 420 430 440 450
FQVFRNISGK QSSLPAMSKV RRLHYEGLIF RFKFLMLITL ACAAMTVIFF
460 470 480 490 500
IVSQVTEGHW KWGGVTVQVN SAFFTGIYGM WNLYVFALMF LYAPSHKNYG
510 520 530 540
EDQSNGDLGV HSGEELQLTT TITHVDGPTE IYKLTRKEAQ E
Length:541
Mass (Da):62,253
Last modified:January 9, 2007 - v2
Checksum:i0DAFDF51BBA0C288
GO
Isoform 2 (identifier: Q5T9L3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     36-37: Missing.
     507-541: DLGVHSGEELQLTTTITHVDGPTEIYKLTRKEAQE → MQLPCKSREDCALFVSELYQELFSASKYSFINDNAASGI

Show »
Length:543
Mass (Da):62,552
Checksum:iC0BD7BCC34E22625
GO
Isoform 3 (identifier: Q5T9L3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     36-127: APGPTTAVSY...IAFKLNNQIR → G

Note: No experimental confirmation available.
Show »
Length:450
Mass (Da):51,571
Checksum:iDC0412051D2BDE7A
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti136 – 1361V → A in CAD98094 (PubMed:17974005).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti465 – 4651V → I.1 Publication
Corresponds to variant rs983034 [ dbSNP | Ensembl ].
VAR_029991

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei36 – 12792APGPT…NNQIR → G in isoform 3. 1 PublicationVSP_046143Add
BLAST
Alternative sequencei36 – 372Missing in isoform 2. 1 PublicationVSP_022346
Alternative sequencei507 – 54135DLGVH…KEAQE → MQLPCKSREDCALFVSELYQ ELFSASKYSFINDNAASGI in isoform 2. 1 PublicationVSP_022347Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ323735 mRNA. Translation: ABD58927.1.
AY359035 mRNA. Translation: AAQ89394.1.
AK074984 mRNA. Translation: BAC11333.1.
BX538320 mRNA. Translation: CAD98094.1.
BX648748 mRNA. No translation available.
AL513284 Genomic DNA. Translation: CAI15024.1.
AL513284 Genomic DNA. Translation: CAI15025.1.
AL513284, AL157407 Genomic DNA. Translation: CAI15027.1.
AL157407, AL513284 Genomic DNA. Translation: CAI21993.1.
CH471059 Genomic DNA. Translation: EAX06480.1.
CH471059 Genomic DNA. Translation: EAX06481.1.
BC110826 mRNA. Translation: AAI10827.1.
BC137109 mRNA. Translation: AAI37110.1.
BC137113 mRNA. Translation: AAI37114.1.
CCDSiCCDS30750.1. [Q5T9L3-2]
CCDS53331.1. [Q5T9L3-3]
CCDS642.1. [Q5T9L3-1]
RefSeqiNP_001002292.3. NM_001002292.3. [Q5T9L3-2]
NP_001180263.1. NM_001193334.1. [Q5T9L3-3]
NP_079187.3. NM_024911.6. [Q5T9L3-1]
UniGeneiHs.647659.

Genome annotation databases

EnsembliENST00000262348; ENSP00000262348; ENSG00000116729. [Q5T9L3-1]
ENST00000354777; ENSP00000346829; ENSG00000116729. [Q5T9L3-2]
ENST00000370976; ENSP00000360015; ENSG00000116729. [Q5T9L3-3]
GeneIDi79971.
KEGGihsa:79971.
UCSCiuc001dee.4. human. [Q5T9L3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ323735 mRNA. Translation: ABD58927.1.
AY359035 mRNA. Translation: AAQ89394.1.
AK074984 mRNA. Translation: BAC11333.1.
BX538320 mRNA. Translation: CAD98094.1.
BX648748 mRNA. No translation available.
AL513284 Genomic DNA. Translation: CAI15024.1.
AL513284 Genomic DNA. Translation: CAI15025.1.
AL513284, AL157407 Genomic DNA. Translation: CAI15027.1.
AL157407, AL513284 Genomic DNA. Translation: CAI21993.1.
CH471059 Genomic DNA. Translation: EAX06480.1.
CH471059 Genomic DNA. Translation: EAX06481.1.
BC110826 mRNA. Translation: AAI10827.1.
BC137109 mRNA. Translation: AAI37110.1.
BC137113 mRNA. Translation: AAI37114.1.
CCDSiCCDS30750.1. [Q5T9L3-2]
CCDS53331.1. [Q5T9L3-3]
CCDS642.1. [Q5T9L3-1]
RefSeqiNP_001002292.3. NM_001002292.3. [Q5T9L3-2]
NP_001180263.1. NM_001193334.1. [Q5T9L3-3]
NP_079187.3. NM_024911.6. [Q5T9L3-1]
UniGeneiHs.647659.

3D structure databases

ProteinModelPortaliQ5T9L3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123038. 19 interactions.
IntActiQ5T9L3. 9 interactions.
STRINGi9606.ENSP00000346829.

Protein family/group databases

TCDBi8.A.56.1.2. the wntless protein (wls) family.

PTM databases

iPTMnetiQ5T9L3.
PhosphoSiteiQ5T9L3.

Polymorphism and mutation databases

BioMutaiWLS.
DMDMi122063496.

Proteomic databases

EPDiQ5T9L3.
MaxQBiQ5T9L3.
PaxDbiQ5T9L3.
PRIDEiQ5T9L3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262348; ENSP00000262348; ENSG00000116729. [Q5T9L3-1]
ENST00000354777; ENSP00000346829; ENSG00000116729. [Q5T9L3-2]
ENST00000370976; ENSP00000360015; ENSG00000116729. [Q5T9L3-3]
GeneIDi79971.
KEGGihsa:79971.
UCSCiuc001dee.4. human. [Q5T9L3-1]

Organism-specific databases

CTDi79971.
GeneCardsiWLS.
HGNCiHGNC:30238. WLS.
MIMi611514. gene.
neXtProtiNX_Q5T9L3.
PharmGKBiPA165752781.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IG2W. Eukaryota.
ENOG410XQ06. LUCA.
GeneTreeiENSGT00390000005897.
HOGENOMiHOG000039226.
HOVERGENiHBG055794.
InParanoidiQ5T9L3.
OMAiLDYSRWQ.
OrthoDBiEOG7B05CP.
PhylomeDBiQ5T9L3.
TreeFamiTF105975.

Enzyme and pathway databases

ReactomeiR-HSA-3238698. WNT ligand biogenesis and trafficking.

Miscellaneous databases

ChiTaRSiWLS. human.
GeneWikiiGPR177.
GenomeRNAii79971.
PROiQ5T9L3.
SOURCEiSearch...

Gene expression databases

BgeeiQ5T9L3.
CleanExiHS_GPR177.
ExpressionAtlasiQ5T9L3. baseline and differential.
GenevisibleiQ5T9L3. HS.

Family and domain databases

InterProiIPR009551. Wntless.
[Graphical view]
PANTHERiPTHR13449. PTHR13449. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Wntless, a conserved membrane protein dedicated to the secretion of Wnt proteins from signaling cells."
    Baenziger C., Soldini D., Schuett C., Zipperlen P., Hausmann G., Basler K.
    Cell 125:509-522(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH WNT3A.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT ILE-465.
    Tissue: Endometrium and Uterus.
  5. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung and PNS.
  8. "Secretion of Wnt ligands requires Evi, a conserved transmembrane protein."
    Bartscherer K., Pelte N., Ingelfinger D., Boutros M.
    Cell 125:523-533(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  9. "Wnt signaling requires retromer-dependent recycling of MIG-14/Wntless in Wnt-producing cells."
    Yang P.T., Lorenowicz M.J., Silhankova M., Coudreuse D.Y., Betist M.C., Korswagen H.C.
    Dev. Cell 14:140-147(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiWLS_HUMAN
AccessioniPrimary (citable) accession number: Q5T9L3
Secondary accession number(s): B2RNT2
, Q5JRS7, Q7Z2Z9, Q8NC43
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 9, 2007
Last sequence update: January 9, 2007
Last modified: June 8, 2016
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.