Q5T9A4 (ATD3B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 83.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: ATPase family AAA domain-containing protein 3B Alternative name(s): AAA-TOB3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 648 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in a mitochondrial network organization typical for stem cells, characterized by reduced mitochondrial metabolism, low mtDNA copies and fragmentated mitochondrial network. may act by suppressing ATAD3A function, interfering with ATAD3A interaction with matrix nucleoid complexes. Ref.10 |
| Subunit structure | Forms heterooligomers with ATAD3A. Interacts with components of the mitochondrial ribosome, including MRPL11 and MRPS18B, and with other proteins involved in mitochondrial RNA metabolism, possibly via interaction with ATAD3A. Interacts with GADD45GIP1. Ref.10 Ref.11 |
| Subcellular location | Mitochondrion inner membrane; Peripheral membrane protein. Note: Has been found to co-purify with nucleoids (Ref.11). Since it does not face the mitochondrial matrix, the association with nucleoids could be mediated by ATAD3A. Ref.6 Ref.7 |
| Tissue specificity | Tends to be down-regulated in differentiated cells and re-expressed in pluripotent stem cells or cancer cells (at protein level). Ref.6 Ref.10 |
| Developmental stage | Expressed in proliferating embryonic stem cells and down-regulated during differentiation. Ref.10 |
| Induction | Up-regulated by MYC. Ref.6 |
| Sequence similarities | Belongs to the AAA ATPase family. |
| Sequence caution | The sequence BAA86587.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane Mitochondrion Mitochondrion inner membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| Ligand | ATP-binding Nucleotide-binding |
| PTM | Acetylation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | mitochondrial inner membrane Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW nucleoside-triphosphatase activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q5T9A4-1) Also known as: AAA-TOB3l; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q5T9A4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-118: Missing. 119-128: LSEETRQHQA → MCLCRPLLPQ 252-284: AGLTLLAVGVYSAKNATAVTGRFIEARLGKPSL → NIFIKQGWQVAERQHVGASWSPRSCPCRLCTAL 285-648: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q5T9A4-3) Also known as: AAA-TOB3s; The sequence of this isoform differs from the canonical sequence as follows: 1-46: Missing. 47-94: WSNFDPTGLE...LQLEQQSKLK → MQLEALNLLH...VPAGECCALQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 648 | 648 | ATPase family AAA domain-containing protein 3B | PRO_0000084800 | |||||
Regions | |||||||||
| Topological domain | 1 – 246 | 246 | Mitochondrial intermembrane Potential | ||||||
| Intramembrane | 247 – 264 | 18 | Helical; Potential | ||||||
| Topological domain | 265 – 648 | 384 | Mitochondrial intermembrane Potential | ||||||
| Nucleotide binding | 352 – 359 | 8 | ATP Potential | ||||||
| Coiled coil | 69 – 214 | 146 | Potential | ||||||
| Compositional bias | 18 – 24 | 7 | Poly-Pro | ||||||
Amino acid modifications | |||||||||
| Modified residue | 427 | 1 | N6-acetyllysine Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 118 | 118 | Missing in isoform 2. | VSP_015637 | |||||
| Alternative sequence | 1 – 46 | 46 | Missing in isoform 3. | VSP_015638 | |||||
| Alternative sequence | 47 – 94 | 48 | WSNFD…QSKLK → MQLEALNLLHTLVWARSLCR AGAVQTQERLSGSASPEQVP AGECCALQ in isoform 3. | VSP_015639 | |||||
| Alternative sequence | 119 – 128 | 10 | LSEETRQHQA → MCLCRPLLPQ in isoform 2. | VSP_015640 | |||||
| Alternative sequence | 252 – 284 | 33 | AGLTL…GKPSL → NIFIKQGWQVAERQHVGASW SPRSCPCRLCTAL in isoform 2. | VSP_015641 | |||||
| Alternative sequence | 285 – 648 | 364 | Missing in isoform 2. | VSP_015642 | |||||
| Natural variant | 7 | 1 | V → I. Corresponds to variant rs1240504 [ dbSNP | Ensembl ]. | VAR_048120 | |||||
Experimental info | |||||||||
| Sequence conflict | 149 | 1 | Q → R in AAH02542. Ref.5 | ||||||
| Sequence conflict | 149 | 1 | Q → R in AAH18701. Ref.5 | ||||||
| Sequence conflict | 153 | 1 | E → V in AK128357. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O. DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Thymus. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Leiomyosarcoma and Placenta. |
| [6] | "Molecular characterization of the tumor-associated antigen AAA-TOB3." Schaffrik M., Mack B., Matthias C., Rauch J., Gires O. Cell. Mol. Life Sci. 63:2162-2174(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION OF ISOFORMS 1 AND 3, SUBCELLULAR LOCATION, INDUCTION, TISSUE SPECIFICITY. |
| [7] | "The layered structure of human mitochondrial DNA nucleoids." Bogenhagen D.F., Rousseau D., Burke S. J. Biol. Chem. 283:3665-3675(2008) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, TOPOLOGY. |
| [8] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-427, MASS SPECTROMETRY. |
| [9] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [10] | "ATAD3B is a human embryonic stem cell specific mitochondrial protein, re-expressed in cancer cells, that functions as dominant negative for the ubiquitous ATAD3A." Merle N., Feraud O., Gilquin B., Hubstenberger A., Kieffer-Jacquinot S., Assard N., Bennaceur-Griscelli A., Honnorat J., Baudier J. Mitochondrion 12:441-448(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH ATAD3A, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, TOPOLOGY. |
| [11] | "Mitochondrial nucleoid interacting proteins support mitochondrial protein synthesis." He J., Cooper H.M., Reyes A., Di Re M., Sembongi H., Litwin T.R., Gao J., Neuman K.C., Fearnley I.M., Spinazzola A., Walker J.E., Holt I.J. Nucleic Acids Res. 40:6109-6121(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PROTEINS INVOLVED IN MITOCHONDRIAL TRANSLATION; RNA METABOLISM; ATAD3A AND GADD45GIP1. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB033099 mRNA. Translation: BAA86587.1. Different initiation. AK128357 mRNA. No translation available. AK290586 mRNA. Translation: BAF83275.1. AL157945 Genomic DNA. Translation: CAI22068.1. CH471183 Genomic DNA. Translation: EAW56193.1. BC002542 mRNA. Translation: AAH02542.1. BC009938 mRNA. No translation available. BC018701 mRNA. Translation: AAH18701.1. |
| IPI | IPI00178879. IPI00306048. IPI00443780. |
| RefSeq | NP_114127.3. NM_031921.4. |
| UniGene | Hs.729021. |
3D structure databases | |
| ProteinModelPortal | Q5T9A4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q5T9A4. 6 interactions. |
| STRING | 9606.ENSP00000311766. |
PTM databases | |
| PhosphoSite | Q5T9A4. |
Polymorphism databases | |
| DMDM | 74745646. |
Proteomic databases | |
| PaxDb | Q5T9A4. |
| PRIDE | Q5T9A4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000308647; ENSP00000311766; ENSG00000160072. |
| GeneID | 83858. |
| KEGG | hsa:83858. |
| UCSC | uc001afv.3. human. uc001afw.2. human. uc001afx.3. human. |
Organism-specific databases | |
| CTD | 83858. |
| GeneCards | GC01P001397. |
| HGNC | HGNC:24007. ATAD3B. |
| MIM | 612317. gene. |
| neXtProt | NX_Q5T9A4. |
| PharmGKB | PA134993325. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0465. |
| HOGENOM | HOG000231291. |
| HOVERGEN | HBG058506. |
| InParanoid | Q5T9A4. |
| OMA | RGLLLFM. |
| OrthoDB | EOG4ZCT46. |
| PhylomeDB | Q5T9A4. |
Gene expression databases | |
| ArrayExpress | Q5T9A4. |
| Bgee | Q5T9A4. |
| CleanEx | HS_ATAD3B. |
| Genevestigator | Q5T9A4. |
| GermOnline | ENSG00000160072. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003593. AAA+_ATPase. IPR003959. ATPase_AAA_core. IPR021911. DUF3523. [Graphical view] |
| Pfam | PF00004. AAA. 1 hit. PF12037. DUF3523. 1 hit. [Graphical view] |
| SMART | SM00382. AAA. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | ATAD3B. human. |
| GenomeRNAi | 83858. |
| NextBio | 72857. |
| SOURCE | Search... |
Entry information
| Entry name | ATD3B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q5T9A4 Secondary accession number(s): A8K3H1 Q9ULE7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
