Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

ATPase family AAA domain-containing protein 3B

Gene

ATAD3B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role in a mitochondrial network organization typical for stem cells, characterized by reduced mitochondrial metabolism, low mtDNA copies and fragmentated mitochondrial network. may act by suppressing ATAD3A function, interfering with ATAD3A interaction with matrix nucleoid complexes.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi352 – 359ATPSequence analysis8

GO - Molecular functioni

GO - Biological processi

Keywordsi

LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-6798695 Neutrophil degranulation

Names & Taxonomyi

Protein namesi
Recommended name:
ATPase family AAA domain-containing protein 3B
Alternative name(s):
AAA-TOB3
Gene namesi
Name:ATAD3B
Synonyms:KIAA1273, TOB3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000160072.19
HGNCiHGNC:24007 ATAD3B
MIMi612317 gene
neXtProtiNX_Q5T9A4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini2 – 246Mitochondrial intermembraneSequence analysisAdd BLAST245
Intramembranei247 – 264HelicalSequence analysisAdd BLAST18
Topological domaini265 – 648Mitochondrial intermembraneSequence analysisAdd BLAST384

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi83858
OpenTargetsiENSG00000160072
PharmGKBiPA134993325

Polymorphism and mutation databases

BioMutaiATAD3B
DMDMi74745646

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000848002 – 648ATPase family AAA domain-containing protein 3BAdd BLAST647

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineCombined sources1
Modified residuei427N6-acetyllysineCombined sources1
Modified residuei495N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ5T9A4
MaxQBiQ5T9A4
PaxDbiQ5T9A4
PeptideAtlasiQ5T9A4
PRIDEiQ5T9A4

PTM databases

iPTMnetiQ5T9A4
PhosphoSitePlusiQ5T9A4
SwissPalmiQ5T9A4

Expressioni

Tissue specificityi

Tends to be down-regulated in differentiated cells and re-expressed in pluripotent stem cells or cancer cells (at protein level).2 Publications

Developmental stagei

Expressed in proliferating embryonic stem cells and down-regulated during differentiation.1 Publication

Inductioni

Up-regulated by MYC.1 Publication

Gene expression databases

BgeeiENSG00000160072
CleanExiHS_ATAD3B
GenevisibleiQ5T9A4 HS

Organism-specific databases

HPAiHPA058968
HPA064867
HPA065305

Interactioni

Subunit structurei

Forms heterooligomers with ATAD3A. Interacts with components of the mitochondrial ribosome, including MRPL11 and MRPS18B, and with other proteins involved in mitochondrial RNA metabolism, possibly via interaction with ATAD3A. Interacts with GADD45GIP1.2 Publications

Protein-protein interaction databases

BioGridi123774, 46 interactors
IntActiQ5T9A4, 31 interactors
MINTiQ5T9A4
STRINGi9606.ENSP00000311766

Structurei

3D structure databases

ProteinModelPortaliQ5T9A4
SMRiQ5T9A4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili69 – 214Sequence analysisAdd BLAST146

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi18 – 24Poly-Pro7

Sequence similaritiesi

Belongs to the AAA ATPase family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IT4H Eukaryota
COG0465 LUCA
GeneTreeiENSGT00730000111059
HOGENOMiHOG000231291
HOVERGENiHBG058506
InParanoidiQ5T9A4
KOiK17681
OMAiRSKLIMT
OrthoDBiEOG091G04JN
PhylomeDBiQ5T9A4
TreeFamiTF313922

Family and domain databases

InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR003959 ATPase_AAA_core
IPR021911 DUF3523
IPR027417 P-loop_NTPase
PfamiView protein in Pfam
PF00004 AAA, 1 hit
PF12037 DUF3523, 1 hit
SMARTiView protein in SMART
SM00382 AAA, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5T9A4-1) [UniParc]FASTAAdd to basket
Also known as: AAA-TOB3l

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSWLFGVNKG PKGEGAGPPP PLPPAQPGAE GGGDRGLGDR PAPKDKWSNF
60 70 80 90 100
DPTGLERAAK AARELEHSRY AKEALNLAQM QEQTLQLEQQ SKLKEYEAAV
110 120 130 140 150
EQLKSEQIRA QAEERRKTLS EETRQHQARA QYQDKLARQR YEDQLKQQQL
160 170 180 190 200
LNEENLRKQE ESVQKQEAMR RATVEREMEL RHKNEMLRVE TEARARAKAE
210 220 230 240 250
RENADIIREQ IRLKASEHRQ TVLESIRTAG TLFGEGFRAF VTDRDKVTAT
260 270 280 290 300
VAGLTLLAVG VYSAKNATAV TGRFIEARLG KPSLVRETSR ITVLEALRHP
310 320 330 340 350
IQVSRRLLSR PQDVLEGVVL SPSLEARVRD IAIATRNTKK NRGLYRHILL
360 370 380 390 400
YGPPGTGKTL FAKKLALHSG MDYAIMTGGD VAPMGREGVT AMHKLFDWAN
410 420 430 440 450
TSRRGLLLFM DEADAFLRKR ATEEISKDLR ATLNAFLYHM GQHSNKFMLV
460 470 480 490 500
LASNLPEQFD CAINSRIDVM VHFDLPQQEE RERLVRLHFD NCVLKPATEG
510 520 530 540 550
KRRLKLAQFD YGRKCSEVAR LTEGMSGREI AQLAVSWQAT AYASKDGVLT
560 570 580 590 600
EAMMDACVQD AVQQYRQKMR WLKAEGPGRG VEHPLSGVQG ETLTSWSLAT
610 620 630 640
DPSYPCLAGP CTFRICSWMG TGLCPGPLSP RMSCGGGRPF CPPGHPLL
Length:648
Mass (Da):72,573
Last modified:December 21, 2004 - v1
Checksum:i5133DB55E3415707
GO
Isoform 2 (identifier: Q5T9A4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-118: Missing.
     119-128: LSEETRQHQA → MCLCRPLLPQ
     252-284: AGLTLLAVGVYSAKNATAVTGRFIEARLGKPSL → NIFIKQGWQVAERQHVGASWSPRSCPCRLCTAL
     285-648: Missing.

Note: No experimental confirmation available.
Show »
Length:166
Mass (Da):19,508
Checksum:i15325B2EF9B86B13
GO
Isoform 3 (identifier: Q5T9A4-3) [UniParc]FASTAAdd to basket
Also known as: AAA-TOB3s

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: Missing.
     47-94: WSNFDPTGLE...LQLEQQSKLK → MQLEALNLLH...VPAGECCALQ

Show »
Length:602
Mass (Da):67,608
Checksum:iC787D0F1D620B06F
GO

Sequence cautioni

The sequence BAA86587 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti149Q → R in AAH02542 (PubMed:15489334).Curated1
Sequence conflicti149Q → R in AAH18701 (PubMed:15489334).Curated1
Sequence conflicti153E → V in AK128357 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0481207V → I. Corresponds to variant dbSNP:rs1240504Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0156371 – 118Missing in isoform 2. 1 PublicationAdd BLAST118
Alternative sequenceiVSP_0156381 – 46Missing in isoform 3. 2 PublicationsAdd BLAST46
Alternative sequenceiVSP_01563947 – 94WSNFD…QSKLK → MQLEALNLLHTLVWARSLCR AGAVQTQERLSGSASPEQVP AGECCALQ in isoform 3. 2 PublicationsAdd BLAST48
Alternative sequenceiVSP_015640119 – 128LSEETRQHQA → MCLCRPLLPQ in isoform 2. 1 Publication10
Alternative sequenceiVSP_015641252 – 284AGLTL…GKPSL → NIFIKQGWQVAERQHVGASW SPRSCPCRLCTAL in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_015642285 – 648Missing in isoform 2. 1 PublicationAdd BLAST364

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB033099 mRNA Translation: BAA86587.1 Different initiation.
AK128357 mRNA No translation available.
AK290586 mRNA Translation: BAF83275.1
AL157945 Genomic DNA No translation available.
CH471183 Genomic DNA Translation: EAW56193.1
BC002542 mRNA Translation: AAH02542.1
BC009938 mRNA No translation available.
BC018701 mRNA Translation: AAH18701.1
CCDSiCCDS30.1 [Q5T9A4-1]
RefSeqiNP_001304167.1, NM_001317238.1 [Q5T9A4-3]
NP_114127.3, NM_031921.5 [Q5T9A4-1]
UniGeneiHs.729021

Genome annotation databases

EnsembliENST00000308647; ENSP00000311766; ENSG00000160072 [Q5T9A4-1]
GeneIDi83858
KEGGihsa:83858
UCSCiuc001afv.4 human [Q5T9A4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiATD3B_HUMAN
AccessioniPrimary (citable) accession number: Q5T9A4
Secondary accession number(s): A8K3H1
, Q6ZRB5, Q9BUK4, Q9ULE7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 13, 2005
Last sequence update: December 21, 2004
Last modified: May 23, 2018
This is version 131 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health