Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q5T9A4

- ATD3B_HUMAN

UniProt

Q5T9A4 - ATD3B_HUMAN

Protein

ATPase family AAA domain-containing protein 3B

Gene

ATAD3B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 98 (01 Oct 2014)
      Sequence version 1 (21 Dec 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role in a mitochondrial network organization typical for stem cells, characterized by reduced mitochondrial metabolism, low mtDNA copies and fragmentated mitochondrial network. may act by suppressing ATAD3A function, interfering with ATAD3A interaction with matrix nucleoid complexes.1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi352 – 3598ATPSequence Analysis

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. nucleoside-triphosphatase activity Source: InterPro

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    ATPase family AAA domain-containing protein 3B
    Alternative name(s):
    AAA-TOB3
    Gene namesi
    Name:ATAD3B
    Synonyms:KIAA1273, TOB3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:24007. ATAD3B.

    Subcellular locationi

    Mitochondrion inner membrane 2 Publications; Peripheral membrane protein 2 Publications
    Note: Has been found to co-purify with nucleoids (PubMed:22453275). Since it does not face the mitochondrial matrix, the association with nucleoids could be mediated by ATAD3A.1 Publication

    GO - Cellular componenti

    1. mitochondrial inner membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Membrane, Mitochondrion, Mitochondrion inner membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134993325.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 648647ATPase family AAA domain-containing protein 3BPRO_0000084800Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylserine1 Publication
    Modified residuei427 – 4271N6-acetyllysine1 Publication

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiQ5T9A4.
    PaxDbiQ5T9A4.
    PRIDEiQ5T9A4.

    PTM databases

    PhosphoSiteiQ5T9A4.

    Expressioni

    Tissue specificityi

    Tends to be down-regulated in differentiated cells and re-expressed in pluripotent stem cells or cancer cells (at protein level).2 Publications

    Developmental stagei

    Expressed in proliferating embryonic stem cells and down-regulated during differentiation.1 Publication

    Inductioni

    Up-regulated by MYC.1 Publication

    Gene expression databases

    ArrayExpressiQ5T9A4.
    BgeeiQ5T9A4.
    CleanExiHS_ATAD3B.
    GenevestigatoriQ5T9A4.

    Organism-specific databases

    HPAiHPA058968.

    Interactioni

    Subunit structurei

    Forms heterooligomers with ATAD3A. Interacts with components of the mitochondrial ribosome, including MRPL11 and MRPS18B, and with other proteins involved in mitochondrial RNA metabolism, possibly via interaction with ATAD3A. Interacts with GADD45GIP1.2 Publications

    Protein-protein interaction databases

    BioGridi123774. 25 interactions.
    IntActiQ5T9A4. 11 interactions.
    STRINGi9606.ENSP00000311766.

    Structurei

    3D structure databases

    ProteinModelPortaliQ5T9A4.
    SMRiQ5T9A4. Positions 289-571.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini2 – 246245Mitochondrial intermembraneSequence AnalysisAdd
    BLAST
    Topological domaini265 – 648384Mitochondrial intermembraneSequence AnalysisAdd
    BLAST

    Intramembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Intramembranei247 – 26418HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili69 – 214146Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi18 – 247Poly-Pro

    Sequence similaritiesi

    Belongs to the AAA ATPase family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiCOG0465.
    HOGENOMiHOG000231291.
    HOVERGENiHBG058506.
    InParanoidiQ5T9A4.
    KOiK17681.
    OMAiDNCVLKP.
    OrthoDBiEOG7J9VP8.
    PhylomeDBiQ5T9A4.
    TreeFamiTF313922.

    Family and domain databases

    Gene3Di3.40.50.300. 1 hit.
    InterProiIPR003593. AAA+_ATPase.
    IPR003959. ATPase_AAA_core.
    IPR021911. DUF3523.
    IPR027417. P-loop_NTPase.
    [Graphical view]
    PfamiPF00004. AAA. 1 hit.
    PF12037. DUF3523. 1 hit.
    [Graphical view]
    SMARTiSM00382. AAA. 1 hit.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q5T9A4-1) [UniParc]FASTAAdd to Basket

    Also known as: AAA-TOB3l

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSWLFGVNKG PKGEGAGPPP PLPPAQPGAE GGGDRGLGDR PAPKDKWSNF    50
    DPTGLERAAK AARELEHSRY AKEALNLAQM QEQTLQLEQQ SKLKEYEAAV 100
    EQLKSEQIRA QAEERRKTLS EETRQHQARA QYQDKLARQR YEDQLKQQQL 150
    LNEENLRKQE ESVQKQEAMR RATVEREMEL RHKNEMLRVE TEARARAKAE 200
    RENADIIREQ IRLKASEHRQ TVLESIRTAG TLFGEGFRAF VTDRDKVTAT 250
    VAGLTLLAVG VYSAKNATAV TGRFIEARLG KPSLVRETSR ITVLEALRHP 300
    IQVSRRLLSR PQDVLEGVVL SPSLEARVRD IAIATRNTKK NRGLYRHILL 350
    YGPPGTGKTL FAKKLALHSG MDYAIMTGGD VAPMGREGVT AMHKLFDWAN 400
    TSRRGLLLFM DEADAFLRKR ATEEISKDLR ATLNAFLYHM GQHSNKFMLV 450
    LASNLPEQFD CAINSRIDVM VHFDLPQQEE RERLVRLHFD NCVLKPATEG 500
    KRRLKLAQFD YGRKCSEVAR LTEGMSGREI AQLAVSWQAT AYASKDGVLT 550
    EAMMDACVQD AVQQYRQKMR WLKAEGPGRG VEHPLSGVQG ETLTSWSLAT 600
    DPSYPCLAGP CTFRICSWMG TGLCPGPLSP RMSCGGGRPF CPPGHPLL 648
    Length:648
    Mass (Da):72,573
    Last modified:December 21, 2004 - v1
    Checksum:i5133DB55E3415707
    GO
    Isoform 2 (identifier: Q5T9A4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-118: Missing.
         119-128: LSEETRQHQA → MCLCRPLLPQ
         252-284: AGLTLLAVGVYSAKNATAVTGRFIEARLGKPSL → NIFIKQGWQVAERQHVGASWSPRSCPCRLCTAL
         285-648: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:166
    Mass (Da):19,508
    Checksum:i15325B2EF9B86B13
    GO
    Isoform 3 (identifier: Q5T9A4-3) [UniParc]FASTAAdd to Basket

    Also known as: AAA-TOB3s

    The sequence of this isoform differs from the canonical sequence as follows:
         1-46: Missing.
         47-94: WSNFDPTGLE...LQLEQQSKLK → MQLEALNLLH...VPAGECCALQ

    Show »
    Length:602
    Mass (Da):67,608
    Checksum:iC787D0F1D620B06F
    GO

    Sequence cautioni

    The sequence BAA86587.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti149 – 1491Q → R in AAH02542. (PubMed:15489334)Curated
    Sequence conflicti149 – 1491Q → R in AAH18701. (PubMed:15489334)Curated
    Sequence conflicti153 – 1531E → V in AK128357. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti7 – 71V → I.
    Corresponds to variant rs1240504 [ dbSNP | Ensembl ].
    VAR_048120

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 118118Missing in isoform 2. 1 PublicationVSP_015637Add
    BLAST
    Alternative sequencei1 – 4646Missing in isoform 3. 2 PublicationsVSP_015638Add
    BLAST
    Alternative sequencei47 – 9448WSNFD…QSKLK → MQLEALNLLHTLVWARSLCR AGAVQTQERLSGSASPEQVP AGECCALQ in isoform 3. 2 PublicationsVSP_015639Add
    BLAST
    Alternative sequencei119 – 12810LSEETRQHQA → MCLCRPLLPQ in isoform 2. 1 PublicationVSP_015640
    Alternative sequencei252 – 28433AGLTL…GKPSL → NIFIKQGWQVAERQHVGASW SPRSCPCRLCTAL in isoform 2. 1 PublicationVSP_015641Add
    BLAST
    Alternative sequencei285 – 648364Missing in isoform 2. 1 PublicationVSP_015642Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB033099 mRNA. Translation: BAA86587.1. Different initiation.
    AK128357 mRNA. No translation available.
    AK290586 mRNA. Translation: BAF83275.1.
    AL157945 Genomic DNA. Translation: CAI22068.1.
    CH471183 Genomic DNA. Translation: EAW56193.1.
    BC002542 mRNA. Translation: AAH02542.1.
    BC009938 mRNA. No translation available.
    BC018701 mRNA. Translation: AAH18701.1.
    CCDSiCCDS30.1. [Q5T9A4-1]
    RefSeqiNP_114127.3. NM_031921.4. [Q5T9A4-1]
    UniGeneiHs.729021.

    Genome annotation databases

    EnsembliENST00000308647; ENSP00000311766; ENSG00000160072. [Q5T9A4-1]
    GeneIDi83858.
    KEGGihsa:83858.
    UCSCiuc001afv.3. human. [Q5T9A4-1]
    uc001afw.2. human. [Q5T9A4-2]
    uc001afx.3. human. [Q5T9A4-3]

    Polymorphism databases

    DMDMi74745646.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB033099 mRNA. Translation: BAA86587.1 . Different initiation.
    AK128357 mRNA. No translation available.
    AK290586 mRNA. Translation: BAF83275.1 .
    AL157945 Genomic DNA. Translation: CAI22068.1 .
    CH471183 Genomic DNA. Translation: EAW56193.1 .
    BC002542 mRNA. Translation: AAH02542.1 .
    BC009938 mRNA. No translation available.
    BC018701 mRNA. Translation: AAH18701.1 .
    CCDSi CCDS30.1. [Q5T9A4-1 ]
    RefSeqi NP_114127.3. NM_031921.4. [Q5T9A4-1 ]
    UniGenei Hs.729021.

    3D structure databases

    ProteinModelPortali Q5T9A4.
    SMRi Q5T9A4. Positions 289-571.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123774. 25 interactions.
    IntActi Q5T9A4. 11 interactions.
    STRINGi 9606.ENSP00000311766.

    PTM databases

    PhosphoSitei Q5T9A4.

    Polymorphism databases

    DMDMi 74745646.

    Proteomic databases

    MaxQBi Q5T9A4.
    PaxDbi Q5T9A4.
    PRIDEi Q5T9A4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000308647 ; ENSP00000311766 ; ENSG00000160072 . [Q5T9A4-1 ]
    GeneIDi 83858.
    KEGGi hsa:83858.
    UCSCi uc001afv.3. human. [Q5T9A4-1 ]
    uc001afw.2. human. [Q5T9A4-2 ]
    uc001afx.3. human. [Q5T9A4-3 ]

    Organism-specific databases

    CTDi 83858.
    GeneCardsi GC01P001397.
    HGNCi HGNC:24007. ATAD3B.
    HPAi HPA058968.
    MIMi 612317. gene.
    neXtProti NX_Q5T9A4.
    PharmGKBi PA134993325.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0465.
    HOGENOMi HOG000231291.
    HOVERGENi HBG058506.
    InParanoidi Q5T9A4.
    KOi K17681.
    OMAi DNCVLKP.
    OrthoDBi EOG7J9VP8.
    PhylomeDBi Q5T9A4.
    TreeFami TF313922.

    Miscellaneous databases

    ChiTaRSi ATAD3B. human.
    GenomeRNAii 83858.
    NextBioi 72857.
    PROi Q5T9A4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q5T9A4.
    Bgeei Q5T9A4.
    CleanExi HS_ATAD3B.
    Genevestigatori Q5T9A4.

    Family and domain databases

    Gene3Di 3.40.50.300. 1 hit.
    InterProi IPR003593. AAA+_ATPase.
    IPR003959. ATPase_AAA_core.
    IPR021911. DUF3523.
    IPR027417. P-loop_NTPase.
    [Graphical view ]
    Pfami PF00004. AAA. 1 hit.
    PF12037. DUF3523. 1 hit.
    [Graphical view ]
    SMARTi SM00382. AAA. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
      DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Thymus.
    3. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Leiomyosarcoma and Placenta.
    6. "Molecular characterization of the tumor-associated antigen AAA-TOB3."
      Schaffrik M., Mack B., Matthias C., Rauch J., Gires O.
      Cell. Mol. Life Sci. 63:2162-2174(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION OF ISOFORMS 1 AND 3, SUBCELLULAR LOCATION, INDUCTION, TISSUE SPECIFICITY.
    7. "The layered structure of human mitochondrial DNA nucleoids."
      Bogenhagen D.F., Rousseau D., Burke S.
      J. Biol. Chem. 283:3665-3675(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, TOPOLOGY.
    8. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
      Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
      Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-427, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. "ATAD3B is a human embryonic stem cell specific mitochondrial protein, re-expressed in cancer cells, that functions as dominant negative for the ubiquitous ATAD3A."
      Merle N., Feraud O., Gilquin B., Hubstenberger A., Kieffer-Jacquinot S., Assard N., Bennaceur-Griscelli A., Honnorat J., Baudier J.
      Mitochondrion 12:441-448(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH ATAD3A, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, TOPOLOGY.
    11. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
      Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
      Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
    12. Cited for: INTERACTION WITH PROTEINS INVOLVED IN MITOCHONDRIAL TRANSLATION; RNA METABOLISM; ATAD3A AND GADD45GIP1.

    Entry informationi

    Entry nameiATD3B_HUMAN
    AccessioniPrimary (citable) accession number: Q5T9A4
    Secondary accession number(s): A8K3H1
    , Q6ZRB5, Q9BUK4, Q9ULE7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 13, 2005
    Last sequence update: December 21, 2004
    Last modified: October 1, 2014
    This is version 98 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3