Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 618

Gene

ZNF618

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri147 – 16923C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri188 – 21023C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri256 – 27823C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri392 – 41423C2H2-type 4PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 618
Gene namesi
Name:ZNF618
Synonyms:KIAA1952
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:29416. ZNF618.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31532.

Polymorphism and mutation databases

BioMutaiZNF618.
DMDMi74762243.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 954954Zinc finger protein 618PRO_0000286811Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineCombined sources
Cross-linki63 – 63Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki437 – 437Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Acetylation, Isopeptide bond, Ubl conjugation

Proteomic databases

EPDiQ5T7W0.
MaxQBiQ5T7W0.
PRIDEiQ5T7W0.

PTM databases

iPTMnetiQ5T7W0.
PhosphoSiteiQ5T7W0.

Expressioni

Gene expression databases

BgeeiQ5T7W0.
CleanExiHS_ZNF618.
ExpressionAtlasiQ5T7W0. baseline and differential.
GenevisibleiQ5T7W0. HS.

Organism-specific databases

HPAiHPA023116.
HPA061732.

Interactioni

Protein-protein interaction databases

BioGridi125407. 6 interactions.
IntActiQ5T7W0. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ5T7W0.
SMRiQ5T7W0. Positions 138-174, 185-214, 245-286, 382-417.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Contains 4 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri147 – 16923C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri188 – 21023C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri256 – 27823C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri392 – 41423C2H2-type 4PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

GeneTreeiENSGT00390000005114.
HOVERGENiHBG107107.
InParanoidiQ5T7W0.
OMAiARNMHEV.
OrthoDBiEOG7B05C8.
PhylomeDBiQ5T7W0.
TreeFamiTF331270.

Family and domain databases

InterProiIPR012337. RNaseH-like_dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 4 hits.
[Graphical view]
SUPFAMiSSF53098. SSF53098. 1 hit.
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 4 hits.
PS50157. ZINC_FINGER_C2H2_2. 4 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5T7W0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNQPGGAAAP QADGASAAGR KSTASRERLK RSQKSTKVEG PEPVPAEASL
60 70 80 90 100
SAEQGTMTEV KVKTELPDDY IQEVIWQGEA KEEKKAVSKD GTSDVPAEIC
110 120 130 140 150
VVIGGVRNQQ TLDGKAPEGS PHGGSVRSRY SGTWIFDQAL RYASGSYECG
160 170 180 190 200
ICGKKYKYYN CFQTHVRAHR DTEATSGEGA SQSNNFRYTC DICGKKYKYY
210 220 230 240 250
SCFQEHRDLH AVDVFSVEGA PENRADPFDQ GVVATDEVKE EPPEPFQKIG
260 270 280 290 300
PKTGNYTCEF CGKQYKYYTP YQEHVALHAP ISTAPGWEPP DDPDTGSECS
310 320 330 340 350
HPEVSPSPRF VAAKTQTNQS GKKAPASVVR CATLLHRTPP ATQTQTFRTP
360 370 380 390 400
NSGSPASKAT AAESAFSRRV EGKAQNHFEE TNSSSQNSSE PYTCGACGIQ
410 420 430 440 450
FQFYNNLLEH MQSHAADNEN NIASNQSRSP PAVVEEKWKP QAQRNSANNT
460 470 480 490 500
TTSGLTPNSM IPEKERQNIA ERLLRVMCAD LGALSVVSGK EFLKLAQTLV
510 520 530 540 550
DSGARYGAFS VTEILGNFNT LALKHLPRMY NQVKVKVTCA LGSNACLGIG
560 570 580 590 600
VTCHSQSVGP DSCYILTAYQ AEGNHIKSYV LGVKGADIRD SGDLVHHWVQ
610 620 630 640 650
NVLSEFVMSE IRTVYVTDCR VSTSAFSKAG MCLRCSACAL NSVVQSVLSK
660 670 680 690 700
RTLQARSMHE VIELLNVCED LAGSTGLAKE TFGSLEETSP PPCWNSVTDS
710 720 730 740 750
LLLVHERYEQ ICEFYSRAKK MNLIQSLNKH LLSNLAAILT PVKQAVIELS
760 770 780 790 800
NESQPTLQLV LPTYVRLEKL FTAKANDAGT VSKLCHLFLE ALKENFKVHP
810 820 830 840 850
AHKVAMILDP QQKLRPVPPY QHEEIIGKVC ELINEVKESW AEEADFEPAA
860 870 880 890 900
KKPRSAAVEN PAAQEDDRLG KNEVYDYLQE PLFQATPDLF QYWSCVTQKH
910 920 930 940 950
TKLAKLAFWL LAVPAVGARS GCVNMCEQAL LIKRRRLLSP EDMNKLMFLK

SNML
Length:954
Mass (Da):104,956
Last modified:December 21, 2004 - v1
Checksum:iA50304AA0D61B92E
GO
Isoform 2 (identifier: Q5T7W0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-144: Missing.
     252-252: K → MNNITSDIFKKKEVRQCQKRE
     282-363: STAPGWEPPD...SPASKATAAE → K

Note: No experimental confirmation available.
Show »
Length:861
Mass (Da):95,616
Checksum:i825DDF6381A98C7C
GO
Isoform 3 (identifier: Q5T7W0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-144: Missing.
     283-313: TAPGWEPPDDPDTGSECSHPEVSPSPRFVAA → EYLLPVGMGVGGPGTGWASRWPGLWNLARKW
     314-954: Missing.

Note: No experimental confirmation available.
Show »
Length:281
Mass (Da):30,950
Checksum:iB5AADB5EF7126CC6
GO
Isoform 4 (identifier: Q5T7W0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-144: Missing.
     361-361: Missing.

Note: No experimental confirmation available.
Show »
Length:921
Mass (Da):101,449
Checksum:i9A20C9D1122FD746
GO

Sequence cautioni

The sequence AAH36039.1 differs from that shown. Reason: Erroneous termination at position 241. Translated as Glu.Curated
The sequence AAH53892.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAB85538.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti211 – 2111A → T in AAI36288 (PubMed:15489334).Curated
Sequence conflicti662 – 6621I → V in AAH36039 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei113 – 14432Missing in isoform 2, isoform 3 and isoform 4. 2 PublicationsVSP_025179Add
BLAST
Alternative sequencei252 – 2521K → MNNITSDIFKKKEVRQCQKR E in isoform 2. 1 PublicationVSP_025180
Alternative sequencei282 – 36382STAPG…ATAAE → K in isoform 2. 1 PublicationVSP_025181Add
BLAST
Alternative sequencei283 – 31331TAPGW…RFVAA → EYLLPVGMGVGGPGTGWASR WPGLWNLARKW in isoform 3. 1 PublicationVSP_025182Add
BLAST
Alternative sequencei314 – 954641Missing in isoform 3. 1 PublicationVSP_025183Add
BLAST
Alternative sequencei361 – 3611Missing in isoform 4. 1 PublicationVSP_055968

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB075832 mRNA. Translation: BAB85538.1. Different initiation.
AK126896 mRNA. No translation available.
AL162393, AL137850 Genomic DNA. Translation: CAI15242.1.
AL162393, AL137850 Genomic DNA. Translation: CAI15243.1.
AL137850, AL162393 Genomic DNA. Translation: CAI15897.1.
AL137850, AL162393 Genomic DNA. Translation: CAI15898.1.
BC036039 mRNA. Translation: AAH36039.1. Sequence problems.
BC053892 mRNA. Translation: AAH53892.1. Different initiation.
BC012922 mRNA. Translation: AAH12922.1.
BC136287 mRNA. Translation: AAI36288.1.
CCDSiCCDS48008.1. [Q5T7W0-2]
RefSeqiNP_001304969.1. NM_001318040.1. [Q5T7W0-4]
NP_001304970.1. NM_001318041.1.
NP_001304971.1. NM_001318042.1. [Q5T7W0-1]
NP_588615.2. NM_133374.2. [Q5T7W0-2]
UniGeneiHs.349208.

Genome annotation databases

EnsembliENST00000288466; ENSP00000288466; ENSG00000157657. [Q5T7W0-2]
ENST00000374126; ENSP00000363241; ENSG00000157657. [Q5T7W0-1]
ENST00000615615; ENSP00000483198; ENSG00000157657. [Q5T7W0-4]
GeneIDi114991.
KEGGihsa:114991.
UCSCiuc004bic.4. human. [Q5T7W0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB075832 mRNA. Translation: BAB85538.1. Different initiation.
AK126896 mRNA. No translation available.
AL162393, AL137850 Genomic DNA. Translation: CAI15242.1.
AL162393, AL137850 Genomic DNA. Translation: CAI15243.1.
AL137850, AL162393 Genomic DNA. Translation: CAI15897.1.
AL137850, AL162393 Genomic DNA. Translation: CAI15898.1.
BC036039 mRNA. Translation: AAH36039.1. Sequence problems.
BC053892 mRNA. Translation: AAH53892.1. Different initiation.
BC012922 mRNA. Translation: AAH12922.1.
BC136287 mRNA. Translation: AAI36288.1.
CCDSiCCDS48008.1. [Q5T7W0-2]
RefSeqiNP_001304969.1. NM_001318040.1. [Q5T7W0-4]
NP_001304970.1. NM_001318041.1.
NP_001304971.1. NM_001318042.1. [Q5T7W0-1]
NP_588615.2. NM_133374.2. [Q5T7W0-2]
UniGeneiHs.349208.

3D structure databases

ProteinModelPortaliQ5T7W0.
SMRiQ5T7W0. Positions 138-174, 185-214, 245-286, 382-417.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125407. 6 interactions.
IntActiQ5T7W0. 1 interaction.

PTM databases

iPTMnetiQ5T7W0.
PhosphoSiteiQ5T7W0.

Polymorphism and mutation databases

BioMutaiZNF618.
DMDMi74762243.

Proteomic databases

EPDiQ5T7W0.
MaxQBiQ5T7W0.
PRIDEiQ5T7W0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000288466; ENSP00000288466; ENSG00000157657. [Q5T7W0-2]
ENST00000374126; ENSP00000363241; ENSG00000157657. [Q5T7W0-1]
ENST00000615615; ENSP00000483198; ENSG00000157657. [Q5T7W0-4]
GeneIDi114991.
KEGGihsa:114991.
UCSCiuc004bic.4. human. [Q5T7W0-1]

Organism-specific databases

CTDi114991.
GeneCardsiZNF618.
HGNCiHGNC:29416. ZNF618.
HPAiHPA023116.
HPA061732.
neXtProtiNX_Q5T7W0.
PharmGKBiPA31532.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000005114.
HOVERGENiHBG107107.
InParanoidiQ5T7W0.
OMAiARNMHEV.
OrthoDBiEOG7B05C8.
PhylomeDBiQ5T7W0.
TreeFamiTF331270.

Miscellaneous databases

ChiTaRSiZNF618. human.
GenomeRNAii114991.
NextBioi35481983.
PROiQ5T7W0.

Gene expression databases

BgeeiQ5T7W0.
CleanExiHS_ZNF618.
ExpressionAtlasiQ5T7W0. baseline and differential.
GenevisibleiQ5T7W0. HS.

Family and domain databases

InterProiIPR012337. RNaseH-like_dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 4 hits.
[Graphical view]
SUPFAMiSSF53098. SSF53098. 1 hit.
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 4 hits.
PS50157. ZINC_FINGER_C2H2_2. 4 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins."
    Nagase T., Kikuno R., Ohara O.
    DNA Res. 8:319-327(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Amygdala.
  3. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4).
    Tissue: Eye, Kidney and Testis.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  8. "SUMO-2 orchestrates chromatin modifiers in response to DNA damage."
    Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C.
    Cell Rep. 10:1778-1791(2015) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-63, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "System-wide analysis of SUMOylation dynamics in response to replication stress reveals novel small ubiquitin-like modified target proteins and acceptor lysines relevant for genome stability."
    Xiao Z., Chang J.G., Hendriks I.A., Sigurdsson J.O., Olsen J.V., Vertegaal A.C.
    Mol. Cell. Proteomics 14:1419-1434(2015) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-63 AND LYS-437, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiZN618_HUMAN
AccessioniPrimary (citable) accession number: Q5T7W0
Secondary accession number(s): B9EG82
, Q4G0X6, Q5T7W1, Q6ZT53, Q7Z6B9, Q8TF49, Q96E49
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: December 21, 2004
Last modified: April 13, 2016
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.