Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

G patch domain-containing protein 4

Gene

GPATCH4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • RNA binding Source: UniProtKB

Names & Taxonomyi

Protein namesi
Recommended name:
G patch domain-containing protein 4
Gene namesi
Name:GPATCH4
Synonyms:GPATC4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

HGNCiHGNC:25982. GPATCH4.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162390084.

Polymorphism and mutation databases

DMDMi147644784.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002874621 – 446G patch domain-containing protein 4Add BLAST446

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei4PhosphothreonineCombined sources1
Modified residuei116PhosphothreonineCombined sources1
Modified residuei128PhosphoserineCombined sources1
Modified residuei130PhosphoserineCombined sources1
Modified residuei139PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ5T3I0.
MaxQBiQ5T3I0.
PaxDbiQ5T3I0.
PeptideAtlasiQ5T3I0.
PRIDEiQ5T3I0.

PTM databases

iPTMnetiQ5T3I0.
PhosphoSitePlusiQ5T3I0.

Expressioni

Gene expression databases

BgeeiENSG00000160818.
CleanExiHS_GPATCH4.

Organism-specific databases

HPAiHPA028323.
HPA054319.

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

IntActiQ5T3I0. 19 interactors.
MINTiMINT-4992280.

Structurei

3D structure databases

ProteinModelPortaliQ5T3I0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini11 – 57G-patchPROSITE-ProRule annotationAdd BLAST47

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili166 – 251Sequence analysisAdd BLAST86

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IMG7. Eukaryota.
ENOG4111R0W. LUCA.
HOGENOMiHOG000015182.
HOVERGENiHBG058275.
InParanoidiQ5T3I0.
PhylomeDBiQ5T3I0.

Family and domain databases

InterProiView protein in InterPro
IPR000467. G_patch_dom.
PfamiView protein in Pfam
PF01585. G-patch. 1 hit.
SMARTiView protein in SMART
SM00443. G_patch. 1 hit.
PROSITEiView protein in PROSITE
PS50174. G_PATCH. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5T3I0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNVTPEVKSR GMKFAEEQLL KHGWTQGKGL GRKENGITQA LRVTLKQDTH
60 70 80 90 100
GVGHDPAKEF TNHWWNELFN KTAANLVVET GQDGVQIRSL SKETTRYNHP
110 120 130 140 150
KPNLLYQKFV KMATLTSGGE KPNKDLESCS DDDNQGSKSP KILTDEMLLQ
160 170 180 190 200
ACEGRTAHKA ARLGITMKAK LARLEAQEQA FLARLKGQDP GAPQLQSESK
210 220 230 240 250
PPKKKKKKRR QKEEEEATAS ERNDADEKHP EHAEQNIRKS KKKKRRHQEG
260 270 280 290 300
KVSDEREGTT KGNEKEDAAG TSGLGELNSR EQTNQSLRKG KKKKRWHHEE
310 320 330 340 350
EKMGVLEEGG KGKEAAGSVR TEEVESRAYA DPCSRRKKRQ QQEEEDLNLE
360 370 380 390 400
DRGEETVLGG GTREAESRAC SDGRSRKSKK KRQQHQEEED ILDVRDEKDG
410 420 430 440
GAREAESRAH TGSSSRGKRK RQQHPKKERA GVSTVQKAKK KQKKRD
Length:446
Mass (Da):50,381
Last modified:May 15, 2007 - v2
Checksum:i51D64BF5B4AEB3C6
GO
Isoform 2 (identifier: Q5T3I0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MNVTPEVKSRGMKFAEEQLLKHGWTQGKGLGRKENGITQALRVTLKQDTHG → MDGLK
     112-185: MATLTSGGEK...AQEQAFLARL → VLEAVGNRVH...GSCHLLREQQ
     186-446: Missing.

Note: No experimental confirmation available.
Show »
Length:139
Mass (Da):15,878
Checksum:i324B017189A519E0
GO
Isoform 3 (identifier: Q5T3I0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MNVTP → MFPRSGPSND

Show »
Length:451
Mass (Da):50,928
Checksum:i381C25148B55AD36
GO

Sequence cautioni

The sequence AAH40147 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAI13052 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAI13053 differs from that shown. The C-terminal sequence differs due to frameshift variations.Curated

Polymorphismi

This gene contains polymorphic substitutions in the last exon causing a frameshift variant C-terminal sequence compared to the official human genome. However, this variant sequence is in agreement with ortholog sequences.

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0254791 – 51MNVTP…QDTHG → MDGLK in isoform 2. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_0408311 – 5MNVTP → MFPRSGPSND in isoform 3. 1 Publication5
Alternative sequenceiVSP_025480112 – 185MATLT…FLARL → VLEAVGNRVHPFSLPWFPWG LNSCLVCLINSQNFPNIVGS CDQPCCCLLRLPRPSAGIEI FRFRGSCHLLREQQ in isoform 2. 1 PublicationAdd BLAST74
Alternative sequenceiVSP_025481186 – 446Missing in isoform 2. 1 PublicationAdd BLAST261

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000256 mRNA. Translation: BAA91036.1.
AK125763 mRNA. Translation: BAC86278.1.
AL365181 Genomic DNA. Translation: CAI13052.1. Sequence problems.
AL365181 Genomic DNA. Translation: CAI13053.1. Sequence problems.
BC032436 mRNA. Translation: AAH32436.1.
BC040147 mRNA. Translation: AAH40147.1. Different initiation.
BC056904 mRNA. No translation available.
CB109133 mRNA. No translation available.
UniGeneiHs.193832.
Hs.708599.

Genome annotation databases

EnsembliENST00000334588; ENSP00000334793; ENSG00000160818.

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.

Entry informationi

Entry nameiGPTC4_HUMAN
AccessioniPrimary (citable) accession number: Q5T3I0
Secondary accession number(s): Q5T3I1
, Q6ZUE7, Q8IWG8, Q9NXH4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: May 15, 2007
Last modified: July 5, 2017
This is version 101 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM