Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

G patch domain-containing protein 4

Gene

GPATCH4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
G patch domain-containing protein 4
Gene namesi
Name:GPATCH4
Synonyms:GPATC4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

HGNCiHGNC:25982. GPATCH4.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162390084.

Polymorphism and mutation databases

DMDMi147644784.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 446446G patch domain-containing protein 4PRO_0000287462Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineCombined sources
Modified residuei4 – 41PhosphothreonineCombined sources
Modified residuei116 – 1161PhosphothreonineCombined sources
Modified residuei128 – 1281PhosphoserineCombined sources
Modified residuei130 – 1301PhosphoserineCombined sources
Modified residuei139 – 1391PhosphoserineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ5T3I0.
MaxQBiQ5T3I0.
PaxDbiQ5T3I0.
PRIDEiQ5T3I0.

PTM databases

iPTMnetiQ5T3I0.
PhosphoSiteiQ5T3I0.

Expressioni

Gene expression databases

BgeeiQ5T3I0.
CleanExiHS_GPATCH4.

Organism-specific databases

HPAiHPA028323.
HPA054319.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CCDC155Q8N6L03EBI-2372076,EBI-749265
CEP70Q8NHQ13EBI-2372076,EBI-739624

Protein-protein interaction databases

IntActiQ5T3I0. 17 interactions.
MINTiMINT-4992280.
STRINGi9606.ENSP00000396441.

Structurei

3D structure databases

ProteinModelPortaliQ5T3I0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini11 – 5747G-patchPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili166 – 25186Sequence analysisAdd
BLAST

Sequence similaritiesi

Contains 1 G-patch domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IMG7. Eukaryota.
ENOG4111R0W. LUCA.
HOGENOMiHOG000015182.
HOVERGENiHBG058275.
InParanoidiQ5T3I0.
OrthoDBiEOG75QR4M.
PhylomeDBiQ5T3I0.

Family and domain databases

InterProiIPR000467. G_patch_dom.
[Graphical view]
PfamiPF01585. G-patch. 1 hit.
[Graphical view]
SMARTiSM00443. G_patch. 1 hit.
[Graphical view]
PROSITEiPS50174. G_PATCH. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5T3I0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNVTPEVKSR GMKFAEEQLL KHGWTQGKGL GRKENGITQA LRVTLKQDTH
60 70 80 90 100
GVGHDPAKEF TNHWWNELFN KTAANLVVET GQDGVQIRSL SKETTRYNHP
110 120 130 140 150
KPNLLYQKFV KMATLTSGGE KPNKDLESCS DDDNQGSKSP KILTDEMLLQ
160 170 180 190 200
ACEGRTAHKA ARLGITMKAK LARLEAQEQA FLARLKGQDP GAPQLQSESK
210 220 230 240 250
PPKKKKKKRR QKEEEEATAS ERNDADEKHP EHAEQNIRKS KKKKRRHQEG
260 270 280 290 300
KVSDEREGTT KGNEKEDAAG TSGLGELNSR EQTNQSLRKG KKKKRWHHEE
310 320 330 340 350
EKMGVLEEGG KGKEAAGSVR TEEVESRAYA DPCSRRKKRQ QQEEEDLNLE
360 370 380 390 400
DRGEETVLGG GTREAESRAC SDGRSRKSKK KRQQHQEEED ILDVRDEKDG
410 420 430 440
GAREAESRAH TGSSSRGKRK RQQHPKKERA GVSTVQKAKK KQKKRD
Length:446
Mass (Da):50,381
Last modified:May 15, 2007 - v2
Checksum:i51D64BF5B4AEB3C6
GO
Isoform 2 (identifier: Q5T3I0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MNVTPEVKSRGMKFAEEQLLKHGWTQGKGLGRKENGITQALRVTLKQDTHG → MDGLK
     112-185: MATLTSGGEK...AQEQAFLARL → VLEAVGNRVH...GSCHLLREQQ
     186-446: Missing.

Note: No experimental confirmation available.
Show »
Length:139
Mass (Da):15,878
Checksum:i324B017189A519E0
GO
Isoform 3 (identifier: Q5T3I0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MNVTP → MFPRSGPSND

Show »
Length:451
Mass (Da):50,928
Checksum:i381C25148B55AD36
GO

Sequence cautioni

The sequence AAH40147.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAI13052.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAI13053.1 differs from that shown.The C-terminal sequence differs due to frameshift variations.Curated

Polymorphismi

This gene contains polymorphic substitutions in the last exon causing a frameshift variant C-terminal sequence compared to the official human genome. However, this variant sequence is in agreement with ortholog sequences.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5151MNVTP…QDTHG → MDGLK in isoform 2. 1 PublicationVSP_025479Add
BLAST
Alternative sequencei1 – 55MNVTP → MFPRSGPSND in isoform 3. 1 PublicationVSP_040831
Alternative sequencei112 – 18574MATLT…FLARL → VLEAVGNRVHPFSLPWFPWG LNSCLVCLINSQNFPNIVGS CDQPCCCLLRLPRPSAGIEI FRFRGSCHLLREQQ in isoform 2. 1 PublicationVSP_025480Add
BLAST
Alternative sequencei186 – 446261Missing in isoform 2. 1 PublicationVSP_025481Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000256 mRNA. Translation: BAA91036.1.
AK125763 mRNA. Translation: BAC86278.1.
AL365181 Genomic DNA. Translation: CAI13052.1. Sequence problems.
AL365181 Genomic DNA. Translation: CAI13053.1. Sequence problems.
BC032436 mRNA. Translation: AAH32436.1.
BC040147 mRNA. Translation: AAH40147.1. Different initiation.
BC056904 mRNA. No translation available.
CB109133 mRNA. No translation available.
UniGeneiHs.193832.
Hs.708599.

Genome annotation databases

EnsembliENST00000334588; ENSP00000334793; ENSG00000160818.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000256 mRNA. Translation: BAA91036.1.
AK125763 mRNA. Translation: BAC86278.1.
AL365181 Genomic DNA. Translation: CAI13052.1. Sequence problems.
AL365181 Genomic DNA. Translation: CAI13053.1. Sequence problems.
BC032436 mRNA. Translation: AAH32436.1.
BC040147 mRNA. Translation: AAH40147.1. Different initiation.
BC056904 mRNA. No translation available.
CB109133 mRNA. No translation available.
UniGeneiHs.193832.
Hs.708599.

3D structure databases

ProteinModelPortaliQ5T3I0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ5T3I0. 17 interactions.
MINTiMINT-4992280.
STRINGi9606.ENSP00000396441.

PTM databases

iPTMnetiQ5T3I0.
PhosphoSiteiQ5T3I0.

Polymorphism and mutation databases

DMDMi147644784.

Proteomic databases

EPDiQ5T3I0.
MaxQBiQ5T3I0.
PaxDbiQ5T3I0.
PRIDEiQ5T3I0.

Protocols and materials databases

DNASUi54865.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000334588; ENSP00000334793; ENSG00000160818.

Organism-specific databases

GeneCardsiGPATCH4.
H-InvDBHIX0001164.
HGNCiHGNC:25982. GPATCH4.
HPAiHPA028323.
HPA054319.
neXtProtiNX_Q5T3I0.
PharmGKBiPA162390084.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IMG7. Eukaryota.
ENOG4111R0W. LUCA.
HOGENOMiHOG000015182.
HOVERGENiHBG058275.
InParanoidiQ5T3I0.
OrthoDBiEOG75QR4M.
PhylomeDBiQ5T3I0.

Miscellaneous databases

NextBioi57760.
PROiQ5T3I0.

Gene expression databases

BgeeiQ5T3I0.
CleanExiHS_GPATCH4.

Family and domain databases

InterProiIPR000467. G_patch_dom.
[Graphical view]
PfamiPF01585. G-patch. 1 hit.
[Graphical view]
SMARTiSM00443. G_patch. 1 hit.
[Graphical view]
PROSITEiPS50174. G_PATCH. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-207 (ISOFORM 1).
    Tissue: Colon mucosa.
  2. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Cervix, Kidney and Ovary.
  4. "Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags."
    Wang A.G., Yoon S.Y., Oh J.H., Jeon Y.J., Kim M., Kim J.M., Byun S.S., Yang J.O., Kim J.H., Kim D.G., Yeom Y.I., Yoo H.S., Kim Y.S., Kim N.S.
    Biochem. Biophys. Res. Commun. 345:1022-1032(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-174 (ISOFORM 3).
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-116; SER-128; SER-130 AND SER-139, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-4, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-130, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiGPTC4_HUMAN
AccessioniPrimary (citable) accession number: Q5T3I0
Secondary accession number(s): Q5T3I1
, Q6ZUE7, Q8IWG8, Q9NXH4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: May 15, 2007
Last modified: March 16, 2016
This is version 93 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.