Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MAGUK p55 subfamily member 7

Gene

MPP7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as an important adapter that promotes epithelial cell polarity and tight junction formation via its interaction with DLG1. Involved in the assembly of protein complexes at sites of cell-cell contact.1 Publication

GO - Molecular functioni

  • cadherin binding Source: BHF-UCL
  • protein-containing complex scaffold activity Source: BHF-UCL
  • protein domain specific binding Source: BHF-UCL
  • protein heterodimerization activity Source: BHF-UCL
  • signaling adaptor activity Source: BHF-UCL

GO - Biological processi

  • bicellular tight junction assembly Source: BHF-UCL
  • establishment of cell polarity Source: BHF-UCL
  • positive regulation of protein complex assembly Source: BHF-UCL
  • protein localization to adherens junction Source: BHF-UCL

Names & Taxonomyi

Protein namesi
Recommended name:
MAGUK p55 subfamily member 7
Gene namesi
Name:MPP7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000150054.18
HGNCiHGNC:26542 MPP7
MIMi610973 gene
neXtProtiNX_Q5T2T1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Membrane, Tight junction

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi38L → S: Abolishes interaction with DLG1. 1 Publication1
Mutagenesisi95L → S: Does not affect the interaction with DLG1. 1 Publication1

Organism-specific databases

DisGeNETi143098
OpenTargetsiENSG00000150054
PharmGKBiPA134985345

Polymorphism and mutation databases

BioMutaiMPP7
DMDMi74762233

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003200271 – 576MAGUK p55 subfamily member 7Add BLAST576

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei409PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ5T2T1
MaxQBiQ5T2T1
PaxDbiQ5T2T1
PeptideAtlasiQ5T2T1
PRIDEiQ5T2T1

PTM databases

iPTMnetiQ5T2T1
PhosphoSitePlusiQ5T2T1

Expressioni

Inductioni

Down-regulated in patients suffering of passive Heymann nephritis (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000150054
CleanExiHS_MPP7
ExpressionAtlasiQ5T2T1 baseline and differential
GenevisibleiQ5T2T1 HS

Organism-specific databases

HPAiHPA037597
HPA037598

Interactioni

Subunit structurei

Heterodimer; able to heterodimerize via its C-terminal L27 domain with LIN7A, LIN7B and LIN7C. Forms a tripartite complex composed of DLG1, MPP7 and LIN7 (LIN7A or LIN7C). Interacts with DLG1 via its N-terminal L27 domain. Interacts with MPP5 and PATJ.4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
LIN7AO149105EBI-2514004,EBI-2513988

GO - Molecular functioni

  • cadherin binding Source: BHF-UCL
  • protein-containing complex scaffold activity Source: BHF-UCL
  • protein domain specific binding Source: BHF-UCL
  • protein heterodimerization activity Source: BHF-UCL

Protein-protein interaction databases

BioGridi126785, 18 interactors
CORUMiQ5T2T1
IntActiQ5T2T1, 15 interactors
STRINGi9606.ENSP00000337907

Structurei

Secondary structure

1576
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi10 – 13Combined sources4
Helixi14 – 19Combined sources6
Helixi21 – 25Combined sources5
Turni26 – 28Combined sources3
Helixi34 – 41Combined sources8
Helixi47 – 61Combined sources15
Helixi72 – 84Combined sources13
Helixi90 – 98Combined sources9
Helixi102 – 115Combined sources14
Helixi121 – 124Combined sources4
Beta strandi138 – 147Combined sources10
Beta strandi151 – 155Combined sources5
Turni157 – 159Combined sources3
Beta strandi162 – 167Combined sources6
Helixi172 – 176Combined sources5
Beta strandi184 – 188Combined sources5
Beta strandi191 – 193Combined sources3
Helixi198 – 207Combined sources10
Beta strandi210 – 217Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3LRAX-ray2.95A9-120[»]
3O46X-ray1.30A135-225[»]
ProteinModelPortaliQ5T2T1
SMRiQ5T2T1
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ5T2T1

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini10 – 65L27 1PROSITE-ProRule annotationAdd BLAST56
Domaini67 – 122L27 2PROSITE-ProRule annotationAdd BLAST56
Domaini139 – 220PDZPROSITE-ProRule annotationAdd BLAST82
Domaini228 – 298SH3PROSITE-ProRule annotationAdd BLAST71
Domaini368 – 560Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST193

Sequence similaritiesi

Belongs to the MAGUK family.Curated

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiKOG0609 Eukaryota
COG0194 LUCA
GeneTreeiENSGT00760000118866
HOGENOMiHOG000233034
HOVERGENiHBG001858
InParanoidiQ5T2T1
OMAiKLETDTH
OrthoDBiEOG091G065I
PhylomeDBiQ5T2T1
TreeFamiTF314263

Family and domain databases

CDDicd12033 SH3_MPP7, 1 hit
InterProiView protein in InterPro
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR014775 L27_C
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR035599 MPP7_SH3
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF02828 L27, 2 hits
PF00595 PDZ, 1 hit
PF07653 SH3_2, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SM00569 L27, 2 hits
SM00228 PDZ, 1 hit
SM00326 SH3, 1 hit
SUPFAMiSSF101288 SSF101288, 1 hit
SSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS51022 L27, 2 hits
PS50106 PDZ, 1 hit
PS50002 SH3, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q5T2T1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPALSTGSGS DTGLYELLAA LPAQLQPHVD SQEDLTFLWD MFGEKSLHSL
60 70 80 90 100
VKIHEKLHYY EKQSPVPILH GAAALADDLA EELQNKPLNS EIRELLKLLS
110 120 130 140 150
KPNVKALLSV HDTVAQKNYD PVLPPMPEDI DDEEDSVKII RLVKNREPLG
160 170 180 190 200
ATIKKDEQTG AIIVARIMRG GAADRSGLIH VGDELREVNG IPVEDKRPEE
210 220 230 240 250
IIQILAQSQG AITFKIIPGS KEETPSKEGK MFIKALFDYN PNEDKAIPCK
260 270 280 290 300
EAGLSFKKGD ILQIMSQDDA TWWQAKHEAD ANPRAGLIPS KHFQERRLAL
310 320 330 340 350
RRPEILVQPL KVSNRKSSGF RKSFRLSRKD KKTNKSMYEC KKSDQYDTAD
360 370 380 390 400
VPTYEEVTPY RRQTNEKYRL VVLVGPVGVG LNELKRKLLI SDTQHYGVTV
410 420 430 440 450
PHTTRARRSQ ESDGVEYIFI SKHLFETDVQ NNKFIEYGEY KNNYYGTSID
460 470 480 490 500
SVRSVLAKNK VCLLDVQPHT VKHLRTLEFK PYVIFIKPPS IERLRETRKN
510 520 530 540 550
AKIISSRDDQ GAAKPFTEED FQEMIKSAQI MESQYGHLFD KIIINDDLTV
560 570
AFNELKTTFD KLETETHWVP VSWLHS
Length:576
Mass (Da):65,524
Last modified:December 21, 2004 - v1
Checksum:i86366E460A08C6A7
GO
Isoform 2 (identifier: Q5T2T1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-125: Missing.
     470-499: TVKHLRTLEFKPYVIFIKPPSIERLRETRK → GPWFLLPLMAVPWGAKPPNARMTCGSPLDL
     500-576: Missing.

Note: No experimental confirmation available.
Show »
Length:374
Mass (Da):42,395
Checksum:iB38B15B10A3A1D54
GO

Sequence cautioni

The sequence CAI12709 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAI13640 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAI17344 differs from that shown. Reason: Erroneous gene model prediction.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_039110322K → R3 PublicationsCorresponds to variant dbSNP:rs2997211Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0560651 – 125Missing in isoform 2. 1 PublicationAdd BLAST125
Alternative sequenceiVSP_056066470 – 499TVKHL…RETRK → GPWFLLPLMAVPWGAKPPNA RMTCGSPLDL in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_056067500 – 576Missing in isoform 2. 1 PublicationAdd BLAST77

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK301592 mRNA Translation: BAG63081.1
AK315046 mRNA Translation: BAG37526.1
AL390866, AL355501, AL391423 Genomic DNA Translation: CAI12708.1
AL390866, AL355501, AL391423 Genomic DNA Translation: CAI12709.1 Sequence problems.
AL355501, AL390866, AL391423 Genomic DNA Translation: CAI13640.1 Sequence problems.
AL355501, AL390866, AL391423 Genomic DNA Translation: CAI13641.1
AL391423, AL355501, AL390866 Genomic DNA Translation: CAI17344.1 Sequence problems.
AL391423, AL355501, AL390866 Genomic DNA Translation: CAI17345.1
CH471072 Genomic DNA Translation: EAW86045.1
CH471072 Genomic DNA Translation: EAW86047.1
BC038105 mRNA Translation: AAH38105.1
CCDSiCCDS7158.1 [Q5T2T1-1]
RefSeqiNP_001305099.1, NM_001318170.1 [Q5T2T1-1]
NP_775767.2, NM_173496.4 [Q5T2T1-1]
XP_011517639.1, XM_011519337.2 [Q5T2T1-1]
UniGeneiHs.499159

Genome annotation databases

EnsembliENST00000337532; ENSP00000337907; ENSG00000150054 [Q5T2T1-1]
ENST00000375719; ENSP00000364871; ENSG00000150054 [Q5T2T1-1]
ENST00000375732; ENSP00000364884; ENSG00000150054 [Q5T2T1-1]
GeneIDi143098
KEGGihsa:143098
UCSCiuc001iua.2 human [Q5T2T1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiMPP7_HUMAN
AccessioniPrimary (citable) accession number: Q5T2T1
Secondary accession number(s): B2RCC9
, B4DWL9, B5MDZ3, D3DRW3, Q5T2T0, Q8IY28
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: December 21, 2004
Last modified: May 23, 2018
This is version 137 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health